CAZyme Information: GBF66633.1

Basic Information

• Species: Trichophyton mentagrophytes
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Trichophyton; Trichophyton mentagrophytes
• CAZyme ID: GBF66633.1
• CAZy Family: GT58
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
265	BFBS01016513|CGC1	29030.89	6.3768

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmentagrophytesTIMM2789	7958	N/A	98	7860

• Gene Location: location=BFBS01016513:222703-223500(-)

Full Sequence      

MVSSVGQGSATRQPNALRVMFVGDSMTQGKQGDWTWRYRMWQWFQAQGIAVTLVGPYTGT
VEPDGPAPPLNKLEDTPKASSIKTSGGYAPGVSPDFDRHHFAVWGRSAAFDKDLIYDVVS
AHPADMMLLMLGFNDLGWLFSKPMDAVASLYGLINNARKANPNLKFAVANIPQRSFIGRG
DLPASTDEYNSILRLALPQWSTEQSPIHLVELQEHYSCGMSNCEAGYDGLHPNAQGEFQI
AHAFTLTLINNFKIGSSPLVIPSNI

Enzyme Prediction     

No EC number prediction in GBF66633.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	17	245	2.7e-48	0.979381443298969

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	2.22e-35	97	248	14	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	7.77e-09	21	236	1	173	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	1.10e-08	99	236	39	176	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238866	sialate_O-acetylesterase_like2	7.27e-06	118	236	44	156	sialate_O-acetylesterase_like subfamily of the SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
225353	TesA	2.93e-04	105	243	55	203	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK39824.1|CE0	1.06e-112	15	265	137	384
BAE63679.1|CE0	2.27e-103	17	263	57	306
SCG40251.1|CE0	1.08e-85	9	265	328	587
UKZ09962.1|CE0	3.39e-82	17	265	512	765
BAE60780.1|CE0	4.77e-80	66	265	19	218

PDB Hits     

GBF66633.1 has no PDB hit.

Swiss-Prot Hits     

GBF66633.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999916	0.000136

TMHMM  Annotations     

There is no transmembrane helices in GBF66633.1.