CAZyme Information: GBF66477.1

Basic Information

• Species: Trichophyton mentagrophytes
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Trichophyton; Trichophyton mentagrophytes
• CAZyme ID: GBF66477.1
• CAZy Family: GT4
• CAZyme Description: glucan 1,3-beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
308		33396.88	6.2809

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmentagrophytesTIMM2789	7958	N/A	98	7860

• Gene Location: location=BFBS01016510:60879-61993(+)

Full Sequence      

MRFSTALSLALAASPAAVLAGGNMGFSLGVKKPDGSCKQRVDFEQDFDALKAHSHIVRTY
SAADCGNTEFLIPAAKDKGFKVVLGIWPDVEESYKADVEALKKVVPGNEDMIAAITVGSE
TLYRGNFTGPELLKKIKDVKQMFPKVKVGTADSWNKYADGTADALITGGVDYFLVNAFAF
WQGKSIEEAPKTLFEDLVGAAKRIADKAPRGTSPYVAIGETGWPTDGGTDYGAAKAGTKN
AEKFYQEGVCPLLVWGVDVFYFEAFDEPWKPKSIGDNGNAADETHWGMYTADRKLKFNAD
CKTNKKKN

Enzyme Prediction     

No EC number prediction in GBF66477.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	25	301	3.5e-35	0.9935691318327974

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	4.25e-68	22	293	44	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	1.54e-41	24	301	1	309	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EER28012.1|GH17	1.02e-151	1	302	1	302
QVM12021.1|GH17	8.31e-151	1	302	1	302
QSS60378.1|GH17	3.95e-148	1	301	1	302
QSS68032.1|GH17	2.28e-147	1	301	1	302
QSS49555.1|GH17	1.86e-146	1	301	1	302

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	9.44e-37	25	296	39	289	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	7.11e-36	25	296	39	289	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]
6FCG_A	1.33e-07	110	297	159	381	Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_B Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_C Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_D Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_E Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_F Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B2W4|BGL2_ARTBC	4.04e-198	1	307	1	307	Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02797 PE=1 SV=1
sp|P15703|BGL2_YEAST	3.85e-71	1	301	1	310	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|Q5AMT2|BGL2_CANAL	3.74e-70	1	304	3	308	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2
sp|P43070|BGL2_CANAX	1.06e-69	1	304	3	308	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1
sp|O13990|BGL2_SCHPO	1.74e-62	11	301	29	318	Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bgl2 PE=2 SV=4

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000288	0.999677	CS pos: 20-21. Pr: 0.9744

TMHMM  Annotations     

There is no transmembrane helices in GBF66477.1.