CAZyme Information: GBF66235.1

Basic Information

• Species: Trichophyton mentagrophytes
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Trichophyton; Trichophyton mentagrophytes
• CAZyme ID: GBF66235.1
• CAZy Family: GT34
• CAZyme Description: D-arabinono-1,4-lactone oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
570		63645.20	5.8997

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmentagrophytesTIMM2789	7958	N/A	98	7860

• Gene Location: location=BFBS01016497:3363-5075(-)

Full Sequence      

MDALITAELAKLDPSVPFRATKSHLHHTWAKTFYSRPELYIQPESVAEIEKVVTLARRCR
RRIVTVGSGHSPSDLTCTSSWVVNLDNYRRVLSFSRDTGVVTVESGIRLRQLGIELEKNG
LMLPNLGSIDEQSIAGVISTGTHGSSLKYGLLSERVLGLSIMLANGQVVRCSEATNPSLF
RAALVSLGAIGIITEMTLQAVPTFNIAWQQSLKTLPQVLDTWDSGLWTSTEYVRVWWMPY
MKRAIVWRADKTDLPTRDPPASWYGGALGYFIYHNLLYLSNYMPRILPWVEWFVFGMQYG
FTPGKTITEAVQPARTGLLMDCLYSQFVNEWALPLEKGPEAITRLSAWFHGDEETARIPF
SSESVWVHCPIEVRVSDTSISKTPRPYLDSTYPDGPTLFLNATLYRPYLRDPPCRERYYE
AFEWLMRDLGGKPHWAKNFGEDLGYEALREMYGDNLDQWLQARNEADPDGMFLGAWHRRH
LLPPSTAASKSPGQTLAFEEQLKEQRVLGAPGAGDGIEWIGTIPGSTPHGNGDMEDGANA
AGSHPSPPTTSASEESFDHLAKGEASITLP

Enzyme Prediction     

EC	1.1.3.-:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	28	236	1.4e-27	0.4606986899563319

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273751	FAD_lactone_ox	1.14e-147	29	473	7	436	sugar 1,4-lactone oxidases. This model represents a family of at least two different sugar 1,4 lactone oxidases, both involved in synthesizing ascorbic acid or a derivative. These include L-gulonolactone oxidase (EC 1.1.3.8) from rat and D-arabinono-1,4-lactone oxidase (EC 1.1.3.37) from Saccharomyces cerevisiae. Members are proposed to have the cofactor FAD covalently bound at a site specified by Prosite motif PS00862; OX2_COVAL_FAD; 1.
397924	ALO	2.17e-111	197	480	2	259	D-arabinono-1,4-lactone oxidase. This domain is specific to D-arabinono-1,4-lactone oxidase EC:1.1.3.-, which is involved in the final step of the D-erythroascorbic acid biosynthesis pathway.
223354	GlcD	4.39e-43	36	472	31	450	FAD/FMN-containing dehydrogenase [Energy production and conversion].
215258	PLN02465	1.95e-39	29	485	89	573	L-galactono-1,4-lactone dehydrogenase
396238	FAD_binding_4	7.56e-36	37	172	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO63154.1|AA7	2.07e-11	37	195	62	223
AEO56694.1|AA7	2.01e-10	82	195	121	234
CCA69005.1|AA7	2.18e-10	37	203	58	229
QRW22693.1|AA7	5.96e-10	28	203	52	229
QSZ37541.1|AA7|CBM18	7.52e-10	16	231	49	270

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7A24_z	3.44e-27	24	260	110	348	Assembly intermediate of the plant mitochondrial complex I [Brassica oleracea]
2VFR_A	1.38e-15	29	206	13	186	Alditol Oxidase from Streptomyces coelicolor A3(2): Native Enzyme [Streptomyces coelicolor A3(2)],2VFS_A Alditol Oxidase from Streptomyces coelicolor A3(2): Complex with Xylitol [Streptomyces coelicolor A3(2)],2VFT_A Alditol Oxidase from Streptomyces coelicolor A3(2): Complex with Sorbitol [Streptomyces coelicolor A3(2)],2VFU_A Alditol Oxidase from Streptomyces coelicolor A3(2): Complex with Mannitol [Streptomyces coelicolor A3(2)],2VFV_A Alditol Oxidase from Streptomyces coelicolor A3(2): Complex with Sulphite [Streptomyces coelicolor A3(2)]
6EO5_A	1.44e-10	37	197	48	212	Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens],6EO5_B Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens]
6EO4_A	1.44e-10	37	197	48	212	Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens],6EO4_B Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens]
6LPN_A	1.45e-10	29	202	46	228	Chain A, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPN_B Chain B, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPP_A Chain A, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPP_B Chain B, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPQ_A Chain A, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPQ_B Chain B, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPT_A Chain A, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPT_B Chain B, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPU_A Chain A, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPU_B Chain B, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPX_A Chain A, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPX_B Chain B, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7SGY1|ALO_NEUCR	6.13e-202	13	521	27	548	Putative D-arabinono-1,4-lactone oxidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=alo-1 PE=3 SV=1
sp|Q6CG88|ALO_YARLI	2.47e-132	20	482	9	525	D-arabinono-1,4-lactone oxidase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ALO1 PE=3 SV=1
sp|O93852|ALO1_CANAL	1.35e-115	17	480	10	552	D-arabinono-1,4-lactone oxidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ALO1 PE=1 SV=1
sp|Q752Y3|ALO_ASHGO	2.47e-112	22	473	14	513	D-arabinono-1,4-lactone oxidase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=ALO1 PE=3 SV=1
sp|Q6FS20|ALO_CANGA	8.81e-111	18	473	6	509	D-arabinono-1,4-lactone oxidase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=ALO1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000000

TMHMM  Annotations     

There is no transmembrane helices in GBF66235.1.