CAZyme Information: GBF66042.1

Basic Information

• Species: Trichophyton mentagrophytes
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Trichophyton; Trichophyton mentagrophytes
• CAZyme ID: GBF66042.1
• CAZy Family: GT31
• CAZyme Description: endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
889	BFBS01016487|CGC1	98996.06	6.3673

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmentagrophytesTIMM2789	7958	N/A	98	7860

• Gene Location: location=BFBS01016487:6507-9362(+)

Full Sequence      

MFRFRQYRVYLIFSIISILAIIHFSGFGGLSTSSYAPPVPVLRPDGPKQPQQPQQQPQPQ
PQPPVKDENKQKPIPPPTPPVPEKGQQGQQDGGVVKPPPPVKETPPPPAVPAPPANIPSN
NGHNLPGGKGRQEIEDGDDSETSLPRWEKQPEHFPVASENVIPLPKGTPKNLPKVQFKFP
PEPARAKDERQQKLARIKNSLKHAWDGYRERAWMHDEVRPQSGGYRDPFMGWGATLVDSL
DTLWIAGMKEEFEEAVRAVGKIDFKVSKRKDIPLFETVIRYLGGLIGAYDISDGQYGTLL
DKAIELAEILMGAFDTPNRMPVTYYMWSPEFASRRRRSGKRVVLAELGSLSIEFTRLAQI
TGNNRYYDAIARITNALEKWQPETSVPGLWPSFLDASGCKTLPRKQRPQHRIPDFPPSNS
GVSGSSSQQQRPQQDNTGLGKRDGDALLPGEEPANYGGTETSLPRVDTAPPLKLDIPADK
PWQRPETEFAEECEEQGLTYPPGVVSATYTLAALADSVYEYLPKTYALLGGLNDQYKNMY
KLARDATMKRIAFRPMLPDSRDILFIADTTTSTTAGDGRGFDYNYHPSHLGCFVGGMFGL
GSKLFGLEEDLEIAKKMTDGCVWAYNATTSQIMPEVFAVLPCKDMHNCKWNQTAYNHAVY
PQNSMQQLSPDSLIGMRDAIDAVVKNPTAINKVDAGTPTTPPFPEKQGLGRPQQTRYPPD
GGNFAKRGDARETPIPDRIIGDPSRPVPGGAVVPTSTPMSHAQLVDKHIRDERIPPGMTE
VNSAKYILRPEAIESVFIMYRITGDEAWREKGWEMFMAIERATRTDYGHSAIGDVTSKEP
GFQDEMESFWIGETLKYFYLLFSDPEVVSLDDYVLNTEAHPHKRPSLAY

Enzyme Prediction     

EC	3.2.1.113:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	201	883	1.6e-169	0.9932735426008968

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	0.0	202	884	3	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	2.13e-91	132	885	16	519	glycoside hydrolase family 47 protein; Provisional
224250	YyaL	1.45e-04	179	393	370	574	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS63392.1|GH47	5.15e-261	128	885	143	861
QSS69163.1|GH47	5.30e-260	128	885	139	858
QSS51165.1|GH47	9.69e-258	128	885	139	858
QKX63570.1|GH47	3.38e-235	140	885	162	897
CAK47995.1|GH47	5.39e-226	134	885	141	868

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1X9D_A	2.82e-42	132	881	14	531	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]
5KIJ_A	2.88e-42	203	881	15	448	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	3.23e-42	203	881	20	453	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	3.35e-42	203	881	20	453	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
2RI8_A	8.09e-42	191	881	3	470	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9NR34|MA1C1_HUMAN	4.96e-41	196	881	177	614	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IC OS=Homo sapiens OX=9606 GN=MAN1C1 PE=1 SV=1
sp|O18498|MA1A1_SPOFR	5.66e-41	186	881	190	641	Mannosyl-oligosaccharide alpha-1,2-mannosidase IA OS=Spodoptera frugiperda OX=7108 PE=1 SV=1
sp|P31723|MAN12_PENCI	7.71e-41	191	881	38	505	Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Penicillium citrinum OX=5077 GN=MSDC PE=1 SV=2
sp|Q9UKM7|MA1B1_HUMAN	9.90e-41	132	881	175	692	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN1B1 PE=1 SV=2
sp|D4AV26|MNS1B_ARTBC	4.52e-40	197	881	44	504	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase ARB_00035 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00035 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000008

TMHMM  Annotations     

Start	End
7	29