CAZyme Information: GBF65489.1

Basic Information

• Species: Trichophyton mentagrophytes
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Trichophyton; Trichophyton mentagrophytes
• CAZyme ID: GBF65489.1
• CAZy Family: GT21
• CAZyme Description: trehalose-phosphatase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
901	BFBS01016472|CGC2	101465.76	6.8783

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmentagrophytesTIMM2789	7958	N/A	98	7860

• Gene Location: location=BFBS01016472:47766-50587(-)

Full Sequence      

MASNLPGGPPAGPSLMSLGVLDASVNTPTQRTPSLVGDNPNGAQNDLSADARTNTDSRST
SISLPLREISASTKPDQHPDLGLSGRIISAAFCIPYKLQIHHDGEWELKNRPGTAALFDS
FANLASPDSHWSHTLVGWTGEIEQQSPSDTPSYHLQNSRVASPTNKTWAPIPVNSSQKPQ
PPPIDGIRVTADDRRRLESQVSSSKFGNILPVWLSDELDSPDQEMQLKDQGRWRRYAERE
IYTLFHYKQHGPTDGRSERQWWQDYQRLNSLFADRILETYKPGDIVWIHDYHLFLLPNLL
RQKVPNIYIGFFLHVPFPSSEFLRCLSKRKDILTGALGANMIGFQSHTYARHFTSCCTRI
LAFSSTKGGIDAYGAHVAVDVFPIGIDVQTVRKLAYGDPNIENTIFNIKTIYSDKKIIVG
RDRLDSVRGVTQKLMAFEMFLERYPQWRGKVVLIQVTSPTSMEEQKEEPDNKLSTQISQL
VSTINGRFGSISFSPVQYYPQYLPRHEYFALLRAADVGLITSVRDGMNTTSLEYVVCQHK
NQGPLILSEFSGTAGILEDAIHINPWDLTGVANAINTALTMTPETKAKKQSALYEHVTTH
TVVEWYDEYLKRLLANLSSFNKSIITPALDKHKLISQYRSARRRLFMFDYDGTLTPIVKD
PQAAIPSDRVLRTLKSLAADPKNAVWIISGRDQNFLEEWMGHITELGLSAEHGCFIRKPR
SEEWTNLAAKANMSWQNDVLEIFQYFTERTPGAFIERKRVALTWHYRPVDPEYGAHQAKE
CRAELERTVATKWPVDIMEGKANLEVRPAFVNKGEIAKRLIDEYAGVHGHEPEFVLCLGD
DFTDEDMFRALKSSDLPPDHVFSVTVGASSKQTQASWHLREPADVISTVTLLNNSKSAVL
E

Enzyme Prediction     

EC	3.1.3.12:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	81	613	2.8e-155	0.9768421052631578

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184712	PRK14501	0.0	182	885	49	716	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
340820	GT20_TPS	0.0	86	613	1	462	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	1.83e-172	186	613	53	468	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
215556	PLN03064	3.20e-158	236	897	181	854	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
223457	OtsA	1.85e-153	208	613	86	477	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS67563.1|GT20	0.0	78	898	97	922
QMW46130.1|GT20	0.0	64	897	97	942
QRD94182.1|GT20	0.0	64	897	30	875
BAE63282.1|GT20	0.0	64	897	30	875
QMW34075.1|GT20	0.0	64	897	97	942

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DXN_A	4.20e-148	626	894	3	271	Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 2 [Aspergillus fumigatus Af293],5DXO_A Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 3 [Aspergillus fumigatus Af293],5DXO_B Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 3 [Aspergillus fumigatus Af293]
5DXF_A	2.40e-146	81	616	27	526	Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314],5DXF_B Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314]
5DXL_A	1.80e-143	626	895	3	272	Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 1 [Aspergillus fumigatus Af293]
5DXI_A	4.82e-96	626	892	5	297	Structure of C. albicans Trehalose-6-phosphate phosphatase C-terminal domain [Candida albicans SC5314],5DXI_B Structure of C. albicans Trehalose-6-phosphate phosphatase C-terminal domain [Candida albicans SC5314]
5HUV_A	6.66e-91	186	613	54	467	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P31688|TPS2_YEAST	3.66e-234	86	892	15	846	Trehalose-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS2 PE=1 SV=3
sp|P78875|TPP1_SCHPO	5.45e-221	75	894	27	814	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tpp1 PE=1 SV=2
sp|Q9P4D3|TPS2_ZYGRO	9.56e-212	86	892	10	853	Trehalose-phosphatase OS=Zygosaccharomyces rouxii OX=4956 GN=TPS2 PE=1 SV=1
sp|O14145|TPS2_SCHPO	1.64e-175	86	885	16	842	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tps2 PE=3 SV=1
sp|Q54NU9|TPSB_DICDI	4.59e-164	233	893	139	785	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum OX=44689 GN=tpsB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000002

TMHMM  Annotations     

There is no transmembrane helices in GBF65489.1.