CAZyme Information: GBF64547.1

Basic Information

• Species: Trichophyton mentagrophytes
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Trichophyton; Trichophyton mentagrophytes
• CAZyme ID: GBF64547.1
• CAZy Family: GH72|CBM43
• CAZyme Description: glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1344		148671.04	6.5650

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmentagrophytesTIMM2789	7958	N/A	98	7860

• Gene Location: location=BFBS01016423:4097-9112(+)

Full Sequence      

MSTAWQRVLRALVVASIISIILIYSARQFGPAPAHTPIRDRPDDQHKPFQPPVPAPDQEP
PSLISHPPPVVPTLESSSTDTPRTKPPGTPAGEPTKTAAVTTPSSHPGHVNEAIPGIPSK
IWQTAKHANLSSEYTDMSNTWIVKNPTFRHELLTDESSDDYVRSRYPGSDILALYTRLKI
PILRADLLRYLILLAEGGIWADLDTTCEQPVSNWLPGEISSTNSTIKTGLVVGLEPDADH
GGKKVLTNAVLAAQPGSKHIKAVVDDVVHQLLEIAKQRGVGPEGITLEMISDVVEVTGRK
KMTAKIIESLSKTLNKEIEESDLVKNSGNEPQCLDDVIILPAPAFASYNNNPIPQGRVLV
MHHHAGTWKSAAEEARKNREKQIQEEADQLKKTADEAERKQKEEAEEHKKEEDATKKAKE
DGEKLPAEVVLRAPQPIQYLASAAHTTLTQNFTTSLTTAYLIPSSPAPPTFSMPKDGQTP
RDRGLFVEVEVLFFLPPSTSKNSENNEYNNSISPLRSRSPTLSPSPPFNTQNRRLQLRNA
RFRGALLASASASTSTPATASSSRQVSPPQPQAETWRSTLDGIEDDDKENDWAYEGFHTT
TASSFSRGPHSRRSSILRELGNSTQRRRSQHTSRVPVTSIFPSQLDSPPWSASFGRPNTS
VEDQDQAQDTQTHELELDLDWEEKMQLHPTRKASISSQKSNPFTSLDRIKRPKERNRDGR
RDASQYIEHLENQLAATLQDAELADAKTHAARYKALKTEYRILRQELTEWEEKFDARVQD
EEAVVAERETQLKIRIRVLEREVEVKDNKIRELEWEAEKEAQNRRTLEAVTATNRSLERR
VDVLTELLAQSPGRVELPPPPSASAVDGASSMHSGDGSMCRTPRPKSMFTKIPLSPVRQP
LFHPTSEPDASYSDPCKRGSGDEDSRVFELASVDSGFDSGPSHSQRTSLLSSQSGPGSAT
SLPLSPELQLQGKLQYRKRKMRRFPSGCCTLKPLVLPTASAALSPYAPPVNPSASPGSIQ
QQRLARYFSTLRYSKAGSGYGESLYDDETDGDDADTDAARTDALDSLEGNVAHYQSFEEA
MAGHDLSFDDTEEFGYSPFAASKSRSPGSEAISYEGGGGGTVRRHRNRSRQISTLRIGMS
PINRVISARQHHASLSWLEKLHLSVPQLLSNVRTLTYRILSNAWHSNWRRLGGISWWFLG
LLLGAHTRNQWVRYSMVRNARCLGRSEEARAEDQEPLTPVSVNHRPDTATSLPYSYTPAM
QEWLKFSVTLVLAIGLAIRDGPSTLTCACPPPESDIRSSPDADTMTESELCQSSPKYQAI
RTSLSVLSPSALPRDDEAFDNGLD

Enzyme Prediction     

No EC number prediction in GBF64547.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	138	216	9.2e-18	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	6.16e-22	117	229	82	192	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	8.37e-15	139	218	9	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
274009	SMC_prok_A	2.45e-06	682	840	673	824	chromosome segregation protein SMC, primarily archaeal type. SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]
224117	Smc	3.21e-05	659	853	324	516	Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning].
224117	Smc	4.24e-05	673	850	277	422	Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS14453.1|GT32	2.78e-57	112	389	93	371
CAK46331.1|GT32	3.96e-57	112	390	141	420
BCS02801.1|GT32	6.89e-57	112	389	127	405
QKX62870.1|GT32	9.84e-57	113	386	106	380
QQK48128.1|GT32	1.57e-56	111	379	80	350

PDB Hits     

GBF64547.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	8.04e-20	117	369	142	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	1.44e-19	118	370	131	389	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q5A4E3|OCH1_CANAL	1.43e-15	118	369	100	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	2.94e-11	117	351	96	365	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P38287|CSH1_YEAST	8.81e-08	117	236	62	181	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999924	0.000098

TMHMM  Annotations     

Start	End
7	26