CAZyme Information: GBF63918.1

Basic Information

• Species: Trichophyton mentagrophytes
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Trichophyton; Trichophyton mentagrophytes
• CAZyme ID: GBF63918.1
• CAZy Family: GH33
• CAZyme Description: beta-1,2-xylosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
613		70581.40	7.8639

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmentagrophytesTIMM2789	7958	N/A	98	7860

• Gene Location: location=BFBS01016328:60427-62335(+)

Full Sequence      

MKGRRFTLLAGLASLIVLLFIFFAPNSDERPSIPTPNPGNSPAAAPQRPPPVESFGDENI
SYKNPAGSTGDDLAQHPIERLIQTSREQFKTTHSRQSKTLQQAATEYRRRYGLHPPPHFD
VWFKFAQSRGVQMIDEYDTIYHTLLPFWGVKPKTIRERAREAIGFENALIGLMIRDGNVT
LVDGGGEGEQWKRDAIKGMMATFVKYLPDMDLAFNIHDEPRVVMAHSDLSRLVAEGKQMA
ASNGQQQQQGLQNRWSARPEGLNKGDRIDEVRRTRFNRFAHQPTWTNSRMSCPPDSPARQ
LEDEPVDNTEQYSTSPLGFISNTTAFSDVCLTPSLRQTFGFFERPNALDIVHDLFPIFSQ
SKVSSFQDILYPSPWYWNGNVAYDANQDMDWSAKEDQMYWRGSTTGGFSRAGGWRRQHRQ
LFVRNINSLGPTNILEKSLETGRWAVKQIQRNTLRSLFNVSFSHVGQCDPEDCEAQKEYF
TIVKPAKQQDAWKFKYLVDIDGNAFSGRYYAFLLSKSLVYKLALFREWHDEWLRPWVHFI
PLSFRGTEHYESVRYFAKEEPGKDEAIAIAQDSQKWARKVLRNEDLEVWFFRLLLEYGRV
IDDNRERLGFSSG

Enzyme Prediction     

No EC number prediction in GBF63918.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	333	601	1.1e-78	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	8.72e-21	352	599	28	251	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	3.53e-09	356	599	108	321	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR83603.1|GT90	2.31e-270	1	610	1	598
QGA13289.1|GT90	1.07e-268	62	610	44	588
QQK41201.1|GT90	1.57e-268	75	610	58	589
CAP94438.1|GT90	2.92e-264	75	610	59	590
QKX56622.1|GT90	1.08e-262	76	611	354	887

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	3.01e-10	356	601	154	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]
5L0R_A	4.23e-09	333	607	95	348	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	2.86e-55	59	606	141	661	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|A0NDG6|RUMI_ANOGA	6.53e-10	356	607	163	392	O-glucosyltransferase rumi homolog OS=Anopheles gambiae OX=7165 GN=AGAP004267 PE=3 SV=1
sp|Q8T045|RUMI_DROME	1.60e-09	356	601	166	391	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1
sp|Q16QY8|RUMI_AEDAE	1.12e-08	356	601	163	388	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|Q8NBL1|PGLT1_HUMAN	2.52e-08	333	607	123	376	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.974917	0.025115

TMHMM  Annotations     

Start	End
7	24