CAZyme Information: GBF63343.1

Basic Information

• Species: Trichophyton mentagrophytes
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Trichophyton; Trichophyton mentagrophytes
• CAZyme ID: GBF63343.1
• CAZy Family: GT90
• CAZyme Description: 5'-AMP-activated protein kinase subunit beta

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
461	BFBS01016243|CGC2	50620.51	6.5098

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmentagrophytesTIMM2789	7958	N/A	98	7860

• Gene Location: location=BFBS01016243:86394-87946(-)

Full Sequence      

MGNAPSKAPGATAGVDKKVNRRTSIQALSGSKAPAADPSHSRESATGHHAALKQQTPVHQ
RLQSRTVETPSFGGERLERHNSRKHREGDQYDLPIHSHSRGSQAAHAQQAIPASDNVSAP
SNRDQGETLSTPRPVNIYYATPSNLTRPPRLPLPIGDAMTAPGSPITSGSLGAAMAFDKT
NTEVSPEKSELDPAVDEDDVVQDELDSIVPTGFNKSVPTTIDWRGSGEKVYVTGTFVNWA
RKFKLHKSDIENGVFTTVLQLRPGTHHLKFIVDGTMRTSDQLPTAVDFTNHLVNYIEISA
DEIERPRRESDKPPKVIIPPEIFPPKVLPESLPIDTTEPQEESDKEEPEEEIPMGDFRNI
IPQFLVDIDRNEDGEGYHQAANVIRDSRAPPMLPLFLARSILNSTTPMKDDNSVLNYPNH
TVLNHLATSSIKNGVLATSVTTRYKRKYVTTILYKPTGPTT

Enzyme Prediction     

No EC number prediction in GBF63343.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406865	AMPK1_CBM	8.16e-43	217	304	1	85	Glycogen recognition site of AMP-activated protein kinase. AMPK1_CBM is a family found in close association with AMPKBI pfam04739. The surface of AMPK1_CBM reveals a carbohydrate-binding pocket.
398422	AMPKBI	1.53e-31	390	456	3	69	5'-AMP-activated protein kinase beta subunit, interaction domain. This region is found in the beta subunit of the 5'-AMP-activated protein kinase complex, and its yeast homologs Sip1, Sip2 and Gal83, which are found in the SNF1 kinase complex. This region is sufficient for interaction of this subunit with the kinase complex, but is not solely responsible for the interaction, and the interaction partner is not known. The isoamylase N-terminal domain (pfam02922) is sometimes found in proteins belonging to this family.
214973	AMPKBI	1.10e-29	353	456	3	99	5'-AMP-activated protein kinase beta subunit, interation domain. This region is found in the beta subunit of the 5'-AMP-activated protein kinase complex, and its yeast homologues Sip1, Sip2 and Gal83, which are found in the SNF1 kinase complex. This region is sufficient for interaction of this subunit with the kinase complex, but is not solely responsible for the interaction, and the interaction partner is not known. The isoamylase N-terminal domain is sometimes found in proteins belonging to this family.
199889	E_set_AMPKbeta_like_N	1.59e-25	218	298	1	80	N-terminal Early set domain, a glycogen binding domain, associated with the catalytic domain of AMP-activated protein kinase beta subunit. E or "early" set domains are associated with the catalytic domain of AMP-activated protein kinase beta subunit glycogen binding domain at the N-terminal end. AMPK is a metabolic stress sensing protein that senses AMP/ATP and has recently been found to act as a glycogen sensor as well. The protein functions as an alpha-beta-gamma heterotrimer. This N-terminal domain is the glycogen binding domain of the beta subunit. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, and isoamylase.
199878	E_set	5.62e-05	218	275	1	59	Early set domain associated with the catalytic domain of sugar utilizing enzymes at either the N or C terminus. The E or "early" set domains of sugar utilizing enzymes are associated with different types of catalytic domains at either the N-terminal or C-terminal end. These domains may be related to the immunoglobulin and/or fibronectin type III superfamilies. Members of this family include alpha amylase, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase. A subset of these members were recently identified as members of the CBM48 (Carbohydrate Binding Module 48) family. Members of the CBM48 family include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, isoamylase, and the beta subunit of AMP-activated protein kinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK42261.1|CBM48	2.27e-141	1	461	1	457
BCS02331.1|CBM48	9.59e-138	1	461	1	457
BCS14009.1|CBM48	9.59e-138	1	461	1	457
QKX60053.1|CBM48	1.45e-136	1	447	1	452
QGA21971.1|CBM48	2.04e-135	1	460	1	472

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2QLV_B	4.83e-31	217	456	4	251	Crystal structure of the heterotrimer core of the S. cerevisiae AMPK homolog SNF1 [Saccharomyces cerevisiae],2QLV_E Crystal structure of the heterotrimer core of the S. cerevisiae AMPK homolog SNF1 [Saccharomyces cerevisiae]
6B2E_B	1.85e-24	202	456	64	271	Structure of full length human AMPK (a2b2g1) in complex with a small molecule activator SC4. [Homo sapiens]
4REW_B	4.43e-24	218	456	3	196	Crystal structure of the non-phosphorylated human alpha1 beta2 gamma1 holo-AMPK complex [Homo sapiens]
7JHG_B	4.54e-24	218	456	4	197	Chain B, 5'-AMP-activated protein kinase subunit beta-2 [Homo sapiens],7JHH_B Chain B, 5'-AMP-activated protein kinase subunit beta-2 [Homo sapiens],7JIJ_B Chain B, 5'-AMP-activated protein kinase subunit beta-2 [Homo sapiens],7M74_B Chain B, 5'-AMP-activated protein kinase subunit beta-2 [Homo sapiens]
6C9F_B	9.91e-24	218	456	13	203	AMP-activated protein kinase bound to pharmacological activator R734 [Homo sapiens],6C9G_B AMP-activated protein kinase bound to pharmacological activator R739 [Homo sapiens],6C9H_B non-phosphorylated AMP-activated protein kinase bound to pharmacological activator R734 [Homo sapiens],6C9J_B AMP-activated protein kinase bound to pharmacological activator R734 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P78789|AAKB_SCHPO	1.15e-37	217	455	99	294	5'-AMP-activated protein kinase subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=amk2 PE=1 SV=2
sp|Q04739|GAL83_YEAST	4.06e-29	218	456	163	415	SNF1 protein kinase subunit beta-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAL83 PE=1 SV=1
sp|P34164|SIP2_YEAST	5.40e-29	217	456	164	411	SNF1 protein kinase subunit beta-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SIP2 PE=1 SV=3
sp|O43741|AAKB2_HUMAN	1.96e-24	202	456	64	271	5'-AMP-activated protein kinase subunit beta-2 OS=Homo sapiens OX=9606 GN=PRKAB2 PE=1 SV=1
sp|Q9QZH4|AAKB2_RAT	4.96e-24	202	456	63	270	5'-AMP-activated protein kinase subunit beta-2 OS=Rattus norvegicus OX=10116 GN=Prkab2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000000

TMHMM  Annotations     

There is no transmembrane helices in GBF63343.1.