CAZyme Information: GBF62752.1

Basic Information

• Species: Trichophyton mentagrophytes
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Trichophyton; Trichophyton mentagrophytes
• CAZyme ID: GBF62752.1
• CAZy Family: GH18
• CAZyme Description: beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1059	BFBS01016154|CGC1	112761.17	7.0128

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmentagrophytesTIMM2789	7958	N/A	98	7860

• Gene Location: location=BFBS01016154:5493-9179(-)

Full Sequence      

MVLDIGYRQMGQLFVMGFDGTTVDPQIRSLIEDYHLGAILLSAKNLKSADETAKLVLELQ
TIARQAGHHLPLLIGLDQENGGVNSLFDDTDIRQFPSAMGVAATGSTKLAREVAKATAQE
LRAVGVNWILGPVLDVLTDGKNQPLGVRSVGDDPQEVATYGVESMKGYQDGGVATCGKHF
PSYGNLEVMVSQSDVPVITDTVDQLRLSALIPFRTAISQGLDSMIVGGCSMISQGMNVMH
ACLSEEVIEDLLRSDLGFQGVVVSDCLEMEALSSNIGVGGGTVMALKAGCDLVLLCRSFT
VQQEAISGLRLGVENGMISKERIRQSLARVSAMKARRTNWEQALNPPGISLLSRLRPSHT
NLSIQAYNSSITVVRDRGNLLPLSSILEPDEELLLLTPLVKPLPASAAAAAVAATTTTTT
TTTIAGHGGGERSRESTNSIDASSSSMSSNIKSGEAVFRELGRSLARRRNGRVLHTSYSA
SGVRPIHENLINRASAVIIVTADSNRNLYQHGFTKHVSLICNSSCMNNSTSNNSTHSNSA
RRNSAGYQRPKAVVVVAVSSPYDFAKDPTIGTYVCTYDFTDAALQALVRVLYGEVSPTGR
MPGTLSKSTARRTSQPRQQWLVETWNEERDSAALDTLLTSIRESESGVGSSSSNNTNNED
GSNNSGISSISSSSSSILANVRADTFLLKSADVQECHLVVRNSSTHAINGFCATYFFRST
GTGVIGAILVDPARRRLGIGSSLHSRAIQTLRQQHPDIKQLQLGSRLPGVYLGIPRADPV
ERRRLRRWFAKLGWSMALSRPLCSMVLRDVQSWVQPDGLKKSGSIRSGSSRSSSSIVGSG
EVEYDLVFGEEYADAVIEHVRTSSRQGVAEVYRTALAGEPHCGIIRAKKAGETSITSAAA
AAAAANANGNAASSVVNAGSADGDGEMMVDGLQLGLEDDQLHVHSHSHSRSHGNETLVGS
VVVYNAQSSLARLVPAVREARVRAGGISSPVIPPSVGEYAMLVQGLIVLGIKEIRKQGGN
TVILDCVDGDGNSDSLTAMGFSVLHSFEELTCDAAAWGR

Enzyme Prediction     

No EC number prediction in GBF62752.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	64	294	2.1e-55	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	4.40e-69	9	384	6	351	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	8.77e-60	11	330	7	313	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	2.11e-36	20	344	10	316	beta-hexosaminidase; Provisional
178629	PLN03080	1.69e-13	73	383	91	415	Probable beta-xylosidase; Provisional
185053	PRK15098	1.55e-07	94	334	119	353	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS62698.1|GH3	0.0	4	1057	3	918
QKX54839.1|GH3	0.0	8	1057	17	919
QGA17051.1|GH3	0.0	9	1057	18	946
BCS15461.1|GH3	0.0	8	1057	17	925
BCS03847.1|GH3	0.0	10	1057	1	907

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	1.54e-84	8	820	11	703	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	1.65e-60	8	378	15	380	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	7.42e-41	21	337	71	396	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	2.36e-40	21	337	45	370	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	3.39e-40	21	337	75	400	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	3.82e-40	21	337	71	396	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|Q7WUL3|NAG3_CELFI	2.41e-35	8	384	30	399	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
sp|P48823|HEXA_PSEO7	6.34e-35	21	383	49	425	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|Q3SKU2|NAGZ_THIDA	1.10e-30	20	309	12	296	Beta-hexosaminidase OS=Thiobacillus denitrificans (strain ATCC 25259) OX=292415 GN=nagZ PE=3 SV=1
sp|Q2Y863|NAGZ_NITMU	2.29e-27	15	298	7	285	Beta-hexosaminidase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71) OX=323848 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000069	0.000000

TMHMM  Annotations     

There is no transmembrane helices in GBF62752.1.