CAZyme Information: GBF62621.1

Basic Information

• Species: Trichophyton mentagrophytes
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Trichophyton; Trichophyton mentagrophytes
• CAZyme ID: GBF62621.1
• CAZy Family: GH17
• CAZyme Description: long-chain-alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
749	BFBS01016121|CGC1	79971.00	8.1542

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmentagrophytesTIMM2789	7958	N/A	98	7860

• Gene Location: location=BFBS01016121:8784-11095(-)

Full Sequence      

MALTVQASPLPPAPRPEDIFSPAQWETLLAVADTVIPSIGCTGTADSSTTHLVAQPQFDA
LVSSLRPAAVEDESEAARAAVQFLGESASSIPGFKESMCRTLALHVHQEGLRGIKTILAG
LNNFAVSFALTGSRTPFQHQPYHVRRQILSSWRSSYLPPLRAAHRALVALTKKSWVGSSP
SLPLVLGFPNVPVHGATSESFPYSFLQFPAGDGPEIIETDVVIVGSGCGAGVAAKNLAEA
GHRVIVVEKSYFFPNDHYPMSGCEGAFHLFSNGGAELSDDGSIGVVSGSTWGGGGTINWS
ASLQTQSMVREEWANAGLPLFTSSAYQTSLDRVCDYMGVSADFIQQNHGNSVLMEGARKL
GYSAKAVPQNTGHQKHACGYCTLGCAAGIKQGPAVTFLADAARAGATFIEGFKAEKVLFG
RKLVKGKRVAIGVRGTWTSRDASGATHGTPAITRKVVIKANKVVVSCGTLESPLLLLRSG
LKNPQIGRNLHLHPVIIMSAMFDHETRPWEGSILTSLVSDFENLDGRGHGSKIEAVVMLP
NFFLPLMAWDNGLDYKTFAANARRMAGFISLTRDRDTGRVYPDPNDGRCRIEYTPSAFDR
KHILEGIIGAAKIAYVSGAREIRSSSLAIPTFTRPETSSDAADEGVNNAAFQEWIKKLRT
GVPLPTEQSMFASAHQMGTCRMGISPKTSVVDPNGMVWGTSGLYVADASVFPSASGVNPM
ITNMAITDVTSRKLASTISHDPEVIKSRL

Enzyme Prediction     

No EC number prediction in GBF62621.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	218	735	1.4e-57	0.9653284671532847

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
366272	GMC_oxred_N	1.25e-49	297	495	33	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
225186	BetA	1.17e-33	220	742	9	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.20e-30	574	727	1	140	GMC oxidoreductase. This domain found associated with pfam00732.
235000	PRK02106	6.28e-08	675	713	473	510	choline dehydrogenase; Validated
274143	pyranose_ox	3.99e-07	630	725	436	533	pyranose oxidase. Pyranose oxidase (also called glucose 2-oxidase) converts D-glucose and molecular oxygen to 2-dehydro-D-glucose and hydrogen peroxide. Peroxide production is believed to be important to the wood rot fungi in which this enzyme is found for lignin degradation.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK96886.1|AA3	3.00e-205	10	739	16	735
AEO59298.1|AA3_1|AA8|1.1.99.18	3.51e-10	220	734	250	782
UJO19303.1|AA3_1|AA8|CBM1	1.48e-09	220	734	273	805
ADT70772.1|AA3_1|AA8|1.1.99.18	2.40e-09	220	736	250	784
QRD04249.1|AA3_3	2.66e-09	215	728	10	587

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JBV_A	2.56e-10	461	744	263	541	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	2.56e-10	461	744	263	541	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	3.38e-10	461	744	263	541	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
7DVE_A	1.10e-07	665	746	434	516	Chain A, 6'''-hydroxyparomomycin C oxidase [Microbacterium trichothecenolyticum],7DVE_B Chain B, 6'''-hydroxyparomomycin C oxidase [Microbacterium trichothecenolyticum]
4QI7_A	3.11e-07	214	719	225	748	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B5WWZ8|FAO1_LOTJA	5.44e-84	217	741	235	747	Long-chain-alcohol oxidase FAO1 OS=Lotus japonicus OX=34305 GN=FAO1 PE=1 SV=1
sp|B5WWZ9|FAO2_LOTJA	2.88e-83	217	738	237	746	Long-chain-alcohol oxidase FAO2 OS=Lotus japonicus OX=34305 GN=FAO2 PE=2 SV=1
sp|Q9LW56|FAO3_ARATH	1.37e-81	217	739	231	741	Long-chain-alcohol oxidase FAO3 OS=Arabidopsis thaliana OX=3702 GN=FAO3 PE=1 SV=1
sp|O65709|FAO4A_ARATH	3.42e-81	217	726	222	710	Long-chain-alcohol oxidase FAO4A OS=Arabidopsis thaliana OX=3702 GN=FAO4A PE=3 SV=2
sp|Q9ZWB9|FAO1_ARATH	2.25e-76	217	735	244	749	Long-chain-alcohol oxidase FAO1 OS=Arabidopsis thaliana OX=3702 GN=FAO1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998947	0.001112

TMHMM  Annotations     

There is no transmembrane helices in GBF62621.1.