CAZyme Information: GBF62404.1

Basic Information

• Species: Trichophyton mentagrophytes
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Trichophyton; Trichophyton mentagrophytes
• CAZyme ID: GBF62404.1
• CAZy Family: GH16
• CAZyme Description: O-glycoside alpha-1,2-mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
419	BFBS01016083|CGC1	48591.35	4.7321

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmentagrophytesTIMM2789	7958	N/A	98	7860

• Gene Location: location=BFBS01016083:1145-2669(-)

Full Sequence      

MPTGTPPSIRKISEKYDKVFEVGCREIDTSQPRANAAFVVLARNKELEGVIQSMKSIERH
FNRYYNYPYVFLNDGDFDDNFKDTVTNYTKSSVEFGKIDSSMWGYPDWTDAEVAKEGIRK
QGDAAIMYGGMESYHHMCRFYSGFFYKHELLMKYEWYWRLEPEIKYFCDITYDPFLEMAK
NNKTYGFTIAVKELKETVPNIFRYASAYKRTNNITSQGLWEMFLEDPVEEEKPAEENNAL
PDEILQTQPGAAGLKDVDPEAMEGETYNMCHFWSNFEIARLDFFRSKAYEDFFTMMDRSG
GFWNERWGDAPIHSLAAGALLSPADIHYFRDFGYRHTTIQHCPANAPARQRVRDPYLEQT
TLDPKLRQEEDEYWDSPDPPKENGVGCRCRCDTDIVDVEGKHGSCLADWVKVAGGWASP

Enzyme Prediction     

No EC number prediction in GBF62404.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT15	33	337	9.2e-127	0.9926739926739927

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227353	KTR1	6.41e-145	30	415	77	392	Mannosyltransferase [Carbohydrate transport and metabolism].
396385	Glyco_transf_15	1.29e-109	27	336	36	311	Glycolipid 2-alpha-mannosyltransferase. This is a family of alpha-1,2 mannosyl-transferases involved in N-linked and O-linked glycosylation of proteins. Some of the enzymes in this family have been shown to be involved in O- and N-linked glycan modifications in the Golgi.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS72920.1|GT15	4.98e-280	1	419	83	504
QSS65551.1|GT15	1.42e-279	1	419	83	504
QVM13016.1|GT15	7.77e-275	1	419	83	505
QSS55309.1|GT15	1.76e-265	27	419	1	396
CAP95625.1|GT15	5.82e-263	1	419	82	505

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1S4N_A	3.32e-86	33	343	26	301	Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p [Saccharomyces cerevisiae],1S4N_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p [Saccharomyces cerevisiae],1S4O_A Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: binary complex with GDP/Mn [Saccharomyces cerevisiae],1S4O_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: binary complex with GDP/Mn [Saccharomyces cerevisiae],1S4P_A Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: ternary complex with GDP/Mn and methyl-alpha-mannoside acceptor [Saccharomyces cerevisiae],1S4P_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: ternary complex with GDP/Mn and methyl-alpha-mannoside acceptor [Saccharomyces cerevisiae]
7BOO_A	7.35e-73	33	347	66	353	Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_B Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_C Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_D Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_E Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_F Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOP_A Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_B Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_C Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_D Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_E Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_F Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163]
5A07_A	5.40e-68	9	343	81	388	X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae in complex with GDP [Saccharomyces cerevisiae S288C],5A07_B X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae in complex with GDP [Saccharomyces cerevisiae S288C],5A08_A X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae [Saccharomyces cerevisiae S288C],5A08_B X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94565|OMH4_SCHPO	1.38e-137	7	414	62	434	O-glycoside alpha-1,2-mannosyltransferase homolog 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=omh4 PE=3 SV=2
sp|Q96WW1|OMH5_SCHPO	1.70e-123	9	416	56	418	O-glycoside alpha-1,2-mannosyltransferase homolog 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=omh5 PE=3 SV=2
sp|P40504|KTR7_YEAST	6.62e-114	2	406	51	475	Probable mannosyltransferase KTR7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KTR7 PE=1 SV=1
sp|P53966|KTR5_YEAST	1.23e-109	6	412	52	489	Probable mannosyltransferase KTR5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KTR5 PE=1 SV=1
sp|P46592|MNT2_CANAL	5.41e-86	33	345	139	417	Glycolipid 2-alpha-mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNT2 PE=3 SV=4

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000083	0.000000

TMHMM  Annotations     

There is no transmembrane helices in GBF62404.1.