CAZyme Information: GBF61883.1

Basic Information

• Species: Trichophyton mentagrophytes
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Trichophyton; Trichophyton mentagrophytes
• CAZyme ID: GBF61883.1
• CAZy Family: GH13
• CAZyme Description: GPI mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
459		50879.47	9.0288

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmentagrophytesTIMM2789	7958	N/A	98	7860

• Gene Location: location=BFBS01016029:291885-293420(+)

Full Sequence      

MPTSREMASAVDSLGMLDRPIYTLTKCFCLWKAVLLLIVLASPGPGYDTSTALLLSSDGE
GPGNPGAGSMGWLISHVGLRLARWDSIYFLKIAQRGYLFEQEWAFGYGYTKFLSFLLPES
LRSLQNLAVTGVLLSNLCHYLSVLVLYRLSQATFNSNRKNYNVIPFLAAALHIVTPAGAF
ISAPNGEAAFSFLNFLGYYVFITALNDERQGSYCLRDLKFLSAGAFFAAATSVRSNGLLS
GLLFVYDAVSGLHQIITHGLSWHVIRRLAMVCAGGSLILIGIVGPQYVAYKDFCLAEDPR
PWCNRLFPSIYAWVQSYYWNVGFLRYWTFSNIPLLCIAAPMIIILVYSGVRVWANLLPML
PSKENDPAGHSVRYQARLALPQVVLATLAVTHYHIQIVNRISSGYPLWYWFLASSLVTEN
RSKTSLTPPSLISSHVIMRVIVMYALIQGCLFASFLPPA

Enzyme Prediction     

No EC number prediction in GBF61883.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	25	459	6e-104	0.995085995085995

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	6.46e-44	24	459	4	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	3.77e-18	83	459	76	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS49377.1|GT76	5.59e-141	16	459	19	477
BCR82784.1|GT76	1.08e-132	11	459	9	465
QMW40534.1|GT76	9.20e-131	7	459	5	452
CAP97902.1|GT76	1.22e-130	17	459	20	450
QRD82967.1|GT76	3.70e-130	7	459	5	452

PDB Hits     

GBF61883.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UJS7|GPI18_ASPOR	6.70e-129	7	459	5	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	3.65e-122	13	459	18	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	7.96e-97	19	459	17	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	2.31e-89	11	459	1	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	8.75e-51	23	459	6	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.925599	0.074413

TMHMM  Annotations     

Start	End
21	43
127	149
161	183
188	205
268	290
305	324
331	353
435	457