CAZyme Information: GBF60986.1

Basic Information

• Species: Trichophyton mentagrophytes
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Trichophyton; Trichophyton mentagrophytes
• CAZyme ID: GBF60986.1
• CAZy Family: AA7
• CAZyme Description: initiation-specific alpha-1,6-mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
459		51930.25	6.5030

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmentagrophytesTIMM2789	7958	N/A	98	7860

• Gene Location: location=BFBS01015945:56526-57903(+)

Full Sequence      

MGAVKTIAPKFGGFLPRQMRRALVGCISCLVIVIYLSVAGAFSESKNDYPHSLAPTMEKF
PRKIWQTWKVDPLAFDKRDLDTAKSWVSKNPEYRYEVLTDHNDMYYVETHFGPEGFNRPD
IVDTYRQLTAKIIKADLLRYLVMYVDGGVYTDIDVEAIRPIKRFIPERYNEKDINMVISV
EIDEPSFSDHAILGQKSKSFCQWTFMCKPKLPVMMRLVDNILKWLHGVAKKQGKPISEIV
LDFDEVISGTGPSAFTNAILQEMSENVGEPVKWDTFHDMHESKLVGGFLVLTVEAFAAGQ
GHSDSGNHNARAALVKHHYHASEWPKNHPRYNHPVYGEVEKCNWDRGCVEEWDKNTAAFK
ELSPEEQAKKIALAKLEVDAPPPKVPEVPTWNQPLPGAEQQPNGQPQPPQVPQQVPVEGQ
PIVQNPPLQPGQQFQQPPMQPLQPGQQVQQAPPTQQQQP

Enzyme Prediction     

No EC number prediction in GBF60986.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	81	166	3.1e-19	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.25e-23	58	225	80	247	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.73e-12	78	167	3	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW40889.1|GT32	1.60e-193	12	407	3	398
QMW28814.1|GT32	1.60e-193	12	407	3	398
BAE58544.1|GT32	1.60e-193	12	407	3	398
UDD56882.1|GT32	1.60e-193	12	407	3	398
QRD83354.1|GT32	1.85e-193	12	407	7	402

PDB Hits     

GBF60986.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	7.96e-34	44	324	117	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	1.64e-28	60	317	99	369	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	1.93e-28	59	296	129	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	3.72e-20	61	240	97	301	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	3.07e-06	61	155	58	143	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999979	0.000027

TMHMM  Annotations     

Start	End
21	43