CAZyme Information: GBF60918.1

Basic Information

• Species: Trichophyton mentagrophytes
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Trichophyton; Trichophyton mentagrophytes
• CAZyme ID: GBF60918.1
• CAZy Family: AA7
• CAZyme Description: dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1477		168935.56	6.7316

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmentagrophytesTIMM2789	7958	N/A	98	7860

Full Sequence      

MADFYPSLTQCALVAAAFKILLFPAYKSTDFEVHRNWLAITHSLPVKEWYYEKTSEWTLD
YPPFFAGLEWCLSQIAAFMDPGMLKVQNLNYDSWQTVYFQRSSVIILELMLVYALNRYIK
SAPNQAAKELAHAASLSILLSPGLLIIDHVHFQYNGFLYGILILSIVLARRQSTLLYSGI
TFAILLCFKHIYLYLSLAWFVYLLRAYCLHPSSMFRLQFGNIAKLGVGVVGVFAAAFGPF
AKWGQLLQLKDRLFPFSRGLCHAYWAPNIWAMYSFLDRALILVAPRLGLPVKSGALASVT
RGLVGDTSFAVLPEITKEYTFGLTFVFQVLCLVKLWFQPDWDTFVGAVTNCAFAAFLFGW
HVHEKAVLLIIIPFSLLALKDRRYLGAFRPLAVAGHVSLFPLLFTAAEFPVKTVYTILWL
VLFLFVFGRLAPAPLRPRVFLLDRFSLLYDTVSIPLIVYCSLVHGMVFGKRYEFLPLMFT
SAYAAVGILGSWAGFMVLFKRKPVQYLPKPTIDDDNSEVWVIPETNEVFTNYDHFLQRMN
FYKQRRFICEITGHSSLTFFEALTSETEGSREVNSAFPESLKEPVLRRVQFSTISRIDSL
VDQVFEDFKQDFYPGERVTVLLSNGSRIHGIVREKAKFPEVMHEGRVERRASSRYLVKLT
NRNNEEALVDDEHLVRDRKVFTKQMLRSFIKNTVTRESWSGAPWLVKPQIAEHFHIDTEV
PKHLQYGNKAGKKANVSAEKEEDEAMFGFFASQSRPINSRNKGQKAKSAHELAKAKEEQY
LAYRRALNGNPSFRVDKKGVSKDVIPPPDPHENSFNDLSIVIKQKSPSPLPPPIKYPIED
LDLPPASDCLPRPALKYLNEDEAREKGSSIKMGSIGALLETWNTLNVYCEVFQLDSFTFD
DFVEAIQFSSDDMDCELLVEIHCAVLKTLVNAESDQDGAVQISLPALPEEESEAEEEESE
PEPEPEPEPPRRTTRSSFAKAQAELAEMEQQKPPESEAVEVKKHCAADMFLEYDWIDRLR
KRDFKNGGWEMILVGLLNRLSLKPRLKEACEEILVHMAPLDADPTQETARIQYSTLDVNL
RIQILQIICMLTVETRAVKNYMEECSNQMTEFRKEKIELQRARKVVLEEIRLLHEERKQL
EPEQRDTPTQQDEEMLDAQIDATDDTESAATDSDEPAGPSLRGGVDRTMERKRKQEAEKE
RKEQATKQPKGSKQYQRVLKKMEDEKNKVASIESEIAVLDNDLREADCPRTRVLGKDRFW
NRYYWFERNGMPYEGLPDSSTASANYANGRLWVQGPDEMEREGFIDVPEQVSQEYKQRFG
TTVAKRKEAEEGSSGVSSAQEWGYYDTPEDLDKLMEWLDTRGVRELKLHKELKLQRNHIA
KYMENRTAYLAEKNAPAEESSDQPAMRMSTRTKGQATDQKRGCLKWRNLTALKEIGHLHV
ESARPTKRAKKAAAAESAKETRMTNRQGRPLGRQGTR

Enzyme Prediction     

EC	2.4.1.265:13	2.4.1.-:9

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT57	16	494	5.4e-171	0.9896049896049897

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397324	Alg6_Alg8	0.0	15	492	1	472	ALG6, ALG8 glycosyltransferase family. N-linked (asparagine-linked) glycosylation of proteins is mediated by a highly conserved pathway in eukaryotes, in which a lipid (dolichol phosphate)-linked oligosaccharide is assembled at the endoplasmic reticulum membrane prior to the transfer of the oligosaccharide moiety to the target asparagine residues. This oligosaccharide is composed of Glc(3)Man(9)GlcNAc(2). The addition of the three glucose residues is the final series of steps in the synthesis of the oligosaccharide precursor. Alg6 transfers the first glucose residue, and Alg8 transfers the second one. In the human alg6 gene, a C->T transition, which causes Ala333 to be replaced with Val, has been identified as the cause of a congenital disorder of glycosylation, designated as type Ic OMIM:603147.
402251	WAC_Acf1_DNA_bd	2.76e-52	518	618	1	101	ATP-utilising chromatin assembly and remodelling N-terminal. ACF (for ATP-utilising chromatin assembly and remodelling factor) is a chromatin-remodelling complex that catalyzes the ATP-dependent assembly of periodic nucleosome arrays. The WAC (WSTF/Acf1/cbp146) domain is an approximately 110-residue module present at the N-termini of Acf1-related proteins in a variety of organisms. The DNA-binding region of Acf1 includes the WAC domain, which is necessary for the efficient binding of ACF complex to DNA.
397084	DDT	3.20e-18	874	931	2	57	DDT domain. The DDT domain is named after (DNA binding homeobox and Different Transcription factors) and is approximately 60 residues in length. Along with the WHIM motifs, it comprises an entirely alpha helical module found in diverse eukaryotic chromatin proteins. Based on the structure of Ioc3, this module is inferred to interact with nucleosomal linker DNA and the SLIDE domain of ISWI proteins. The resulting complex forms a protein ruler that measures out the spacing between two adjacent nucleosomes. In particular, the DDT domain, in combination with the WHIM1 and WHIM2 motifs form the SLIDE domain binding pocket.
406128	WSD	1.59e-14	1250	1372	2	65	Williams-Beuren syndrome DDT (WSD), D-TOX E motif. This family represents the combined alpha-helical module found in diverse eukaryotic chromatin proteins. Based on the Ioc3 structure, the N-terminus of this module is inferred to interact with nucleosomal linker DNA and the SLIDE domain of ISWI proteins. The resulting complex forms a protein ruler that measures out the spacing between two adjacent nucleosomes. The acidic residue from the GxD signature at the N-terminus is a major determinant of the interaction between the ISWI and WHIM motifs. The N-terminal portion also contacts the inter-nucleosomal linker DNA. The module shows a great domain architectural diversity and is often combined with other modified histone peptide recognizing and DNA binding domains, some of which discriminate methylated DNA. The WSD module constitutes the inter-nucleosomal linker DNA binding site in the major groove of DNA, and was first identified as WSD, the D-TOX E motif of plant homeodomains homologous with the mutant transcription factor causing Williams-Beuren syndrome in association with the DDT-domain.
406127	WHIM1	1.52e-08	1061	1103	4	46	WSTF, HB1, Itc1p, MBD9 motif 1. A conserved alpha helical motif that along with the WHIM2 and WHIM3 motifs, and the DDT domain comprise an alpha helical module found in diverse eukaryotic chromatin proteins.Based on the Ioc3 structure, this module is inferred to interact with nucleosomal linker DNA and the SLIDE domain of ISWI proteins. The resulting complex forms a protein ruler that measures out the spacing between two adjacent nucleosomes. The conserved basic residue in WHIM1 is involved in packing with the DDT motif. The module shows a great domain architectural diversity and is often combined with other modified histone peptide recognising and DNA binding domains, some of which discriminate methylated DNA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX57890.1|GT57	QKX57890.1|GT57	0.0	1	1477	1	1497
UQC78548.1|GT57	UQC78548.1|GT57	0.0	1	1441	1	1783
CBX97514.1|GT57	CBX97514.1|GT57	0.0	1	1459	1	1758
BCR90425.1|GT57	BCR90425.1|GT57	1.90e-282	1	499	6	504
QSS59954.1|GT57	QSS59954.1|GT57	1.52e-280	1	499	1	501

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SNH_X	6SNH_X	8.33e-26	30	377	87	410	Cryo-EM structure of yeast ALG6 in complex with 6AG9 Fab and Dol25-P-Glc [Saccharomyces cerevisiae],6SNI_X Cryo-EM structure of nanodisc reconstituted yeast ALG6 in complex with 6AG9 Fab [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q1DJR8|ALG8_COCIM	sp|Q1DJR8|ALG8_COCIM	3.61e-298	1	499	1	498	Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Coccidioides immitis (strain RS) OX=246410 GN=ALG8 PE=3 SV=1
sp|Q2UB20|ALG8_ASPOR	sp|Q2UB20|ALG8_ASPOR	1.21e-279	1	499	1	501	Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=alg8 PE=3 SV=1
sp|Q5AWM9|ALG8_EMENI	sp|Q5AWM9|ALG8_EMENI	1.09e-257	1	476	1	475	Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=alg8 PE=3 SV=1
sp|Q7RXP5|ALG8_NEUCR	sp|Q7RXP5|ALG8_NEUCR	1.15e-252	1	499	1	502	Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=alg-8 PE=3 SV=2
sp|Q4IJT0|ALG8_GIBZE	sp|Q4IJT0|ALG8_GIBZE	1.33e-246	1	499	1	498	Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=ALG8 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000018	0.000000

TMHMM  Annotations     

Start	End
150	169
182	204
219	241
254	276
319	337
344	363
385	407
414	431
446	468
475	497