CAZyme Information: GAQ12284.1

Basic Information

• Species: Aspergillus lentulus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus lentulus
• CAZyme ID: GAQ12284.1
• CAZy Family: GT90
• CAZyme Description: beta-glucosidase 1B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
272		30977.86	5.2197

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlentulusIFM54703	9916	N/A	259	9657

• Gene Location: location=BCLY01000017:1820405-1821473(-)

Full Sequence      

MTPVSRATQQPSLEFKSKQGGRIGVSLCGDYIEPWDSSEPKDHEAAERRMEFVIGWFANP
MLLAQDYPMAMRQQLQDRLPAFTEAEFALLREAEVDFYGMNYYTSLFARHRVCPASDTDY
LGNLDEYQVNKSGVSIGDPSGVDWLRSAPQGFRKHLVRIYNKYRKPIYITENGCPCPGED
KMSREESVRDAYRQKYLSDHLDAITGAIQDGVGVSGYFVWSLMDNFEWSSGYTIKFGVTH
INYDTLERTPKESALEIRAMIEGRMNAKVQGA

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	18	262	3.3e-66	0.5011655011655012

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395176	Glyco_hydro_1	1.48e-68	19	262	212	449	Glycosyl hydrolase family 1.
225343	BglB	8.39e-50	21	262	217	451	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215435	PLN02814	1.70e-39	5	270	232	489	beta-glucosidase
184102	PRK13511	2.26e-37	14	255	202	457	6-phospho-beta-galactosidase; Provisional
215455	PLN02849	2.43e-30	4	264	236	483	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK99342.1|GH1	2.13e-135	5	264	225	484
UPK92551.1|GH1	7.14e-129	14	267	215	487
QKD58966.1|GH1	2.88e-128	5	264	223	482
CEI68127.1|GH1	2.49e-126	5	264	223	494
QKD61576.1|GH1	2.64e-120	5	270	216	482

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JBO_A	4.31e-115	5	269	218	483	Trichoderma harzianum GH1 beta-glucosidase ThBgl2 [Trichoderma harzianum]
6KHT_A	5.18e-112	5	264	231	491	Chain A, Glycoside hydrolase family 1 [Trichoderma reesei QM6a],6KHT_B Chain B, Glycoside hydrolase family 1 [Trichoderma reesei QM6a],6KHT_C Chain C, Glycoside hydrolase family 1 [Trichoderma reesei QM6a]
6EFU_A	2.80e-77	14	262	211	460	Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],6EFU_B Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
5JBK_A	2.80e-77	14	262	211	460	Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum],5JBK_B Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum]
5BWF_A	4.57e-77	14	262	230	479	Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],5BWF_B Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q25BW4|BGL1B_PHACH	1.99e-61	14	253	230	463	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
sp|Q25BW5|BGL1A_PHACH	3.36e-59	14	254	215	449	Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
sp|Q9SPP9|RG1_RAUSE	3.36e-58	14	255	260	505	Raucaffricine-O-beta-D-glucosidase OS=Rauvolfia serpentina OX=4060 GN=RG PE=1 SV=1
sp|Q9FIW4|BGL42_ARATH	8.70e-54	14	263	230	481	Beta-glucosidase 42 OS=Arabidopsis thaliana OX=3702 GN=BGLU42 PE=2 SV=1
sp|Q9FZE0|BGL40_ARATH	2.65e-52	14	253	255	498	Beta-glucosidase 40 OS=Arabidopsis thaliana OX=3702 GN=BGLU40 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000004

TMHMM  Annotations     

There is no transmembrane helices in GAQ12284.1.