CAZyme Information: GAQ12279.1

Basic Information

• Species: Aspergillus lentulus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus lentulus
• CAZyme ID: GAQ12279.1
• CAZy Family: GT90
• CAZyme Description: sterol 3-beta-glucosyltransferase UGT80B1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1041	BCLY01000017|CGC23	113875.48	9.0515

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlentulusIFM54703	9916	N/A	259	9657

• Gene Location: location=BCLY01000017:1806435-1810303(+)

Full Sequence      

MATNDNLEVFELPAEPVVLPPSPPAATKGNSGVNMNDEGRVSIDWDSRFVRRFSKLYSGP
FLGRPTTPPPRYSELAPQSADDTVPISEAPPAYPESLVEIEKSWKVKLNIVIQVVGSRGD
VQPFIALGNELQRYGHRVRLATHDVFESFVRDSGLEFYPIGGDPADLMAYMVRNPGLIPS
MESLQAGDIQRKRIMVREMLHGCWRSCIDPDMRTQMPFVADAIIANPPSFAHIHCAQALS
IPVHLMFTMPWSSTKAFPHPLANMSGSNADESLKNYVSYGVVDWLTWQGLGDVINEWRRK
DLDFEDVATFEGPHLAEILKVPFTYCWSPALVPKPLDWPSYVDVCGFFFRDTPEHDPPAD
LKAFLASGSPPVYIGFGSIVLEDPERITTTIINAVNAVGARAIISKGWSNLGGAHHDNIY
YIGDCPHEWLFNYVAAVVHHGGAGTTACGLRYSKPTLIVPFFGDQPFWGAMVAAAGAGPA
PIPHKQLTVEALAAGIRYCLSEQAAAAASTIAHKMRSESGVHTAVASFHRNLPLDRLKCD
LYPSQPAVWSVSVLKSRQKLKLSKFAAEVLVADGLIDQKNLTVHPIKPLLIENRRWDPIT
GGASAVMHTTTDLTGSLLGTFYKPVQEYQDYHRRRKDQRLGSMSIQTSHMSTSSSSVGST
NIEPPSDQGGGKLFARMAGASAKSLGSFVPTALKGMTVDIPLALTEGLRNIPRLHGEEPR
DHGPVTDIKSGFAVAGKGFVWGMTEAVSDIVVKPYQGMQRDGAKGAIKGVGKGMSNMVSK
AGCAMFGVLIYPSAGLAKSLHASIHSRTRKLIVKARCGEGAWMLASGQFTDMDRDQIVTG
FRGISKALSVVFASIDPATLLVSRKTIHPAAPATTQAKATNKPVVQLGRLNLFIPHMQPA
RHPWSIVFHMLHQTTKSIFHVAVAGARAPFIEMSRASVVADLICSQPQSPSQPKHDTTIA
RLFSRSLPDIRQQHHQYRSRNRHGASPNPVTQNSPFRIWEVISIQIRREEYRSLQDGWHM
AGAALQISRNSIPPQATMFSP

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	134	529	1.7e-59	0.9633507853403142

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.75e-63	108	530	1	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	5.17e-32	110	468	4	335	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	2.93e-25	110	258	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR86527.1|GT1	0.0	1	846	1	864
BCR84763.1|GT1	0.0	1	843	1	867
BCR98772.1|GT1	0.0	1	842	1	863
BCS11094.1|GT1	0.0	1	842	1	863
CAP93840.1|GT1	0.0	1	846	1	867

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	2.08e-70	98	536	14	443	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	3.46e-70	98	536	34	463	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
3H4I_A	1.28e-29	108	518	1	368	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1IIR_A	2.99e-28	108	518	1	385	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
1RRV_A	1.51e-25	108	512	1	380	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	1.44e-128	67	533	123	575	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	8.50e-126	95	533	180	611	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q4WID6|ATG26_ASPFU	1.60e-77	108	532	902	1319	Sterol 3-beta-glucosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=atg26 PE=3 SV=2
sp|A1CYS1|ATG26_NEOFI	1.67e-77	108	532	911	1328	Sterol 3-beta-glucosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=atg26 PE=3 SV=1
sp|A1CFB3|ATG26_ASPCL	2.15e-77	108	532	908	1325	Sterol 3-beta-glucosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=atg26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000000

TMHMM  Annotations     

There is no transmembrane helices in GAQ12279.1.