CAZyme Information: GAQ12271.1

Basic Information

• Species: Aspergillus lentulus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus lentulus
• CAZyme ID: GAQ12271.1
• CAZy Family: GT8
• CAZyme Description: cellulose synthase catalytic subunit [UDP-forming]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
627		70368.75	9.0408

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlentulusIFM54703	9916	N/A	259	9657

• Gene Location: location=BCLY01000017:1784620-1786607(+)

Full Sequence      

MLSKHEYDIRELPPDDRIRFSLKYRNTLYLVSKAAIGAFRLYFLVRLLLVITAPQQTWQI
WLMLIVEYIFARMPRNDQLLTVAAGRSSQSRPRDRLRLHGSDHLPRVDVLVPCCGEPTDV
VLDTVRAACTMDYPVTHFRVLLLDDGASSVLRDAVAELRSQWPHLSYHTRGQHSGRVFAK
AGNLNYALFSLQNEVQPEFCAVLDADCMPTSDFLRATLPHLLKDPQAALLTTRQYYYNLP
DGDPLQQSRVHFYTCHNSELDRMGSAIDAGSGAVFRRKTIVDVGGYPTFSFSEDWQLSLM
LQGLGYRTMQVLEPLQLGLVPSSLDGHIAQRNRWQIGHSQQPSVLFSANQSIPRPLQWSI
ALNGVSIILGLVGYMVGFAAVPVLCASGRVIPAASPLLVRIQVFLAVLHIALTWLHGLIQ
SAHTGFCIGPFAHLENSWLASTHMFAIIRFHCFSSKPKGSFVTGSSANSWNRFTELPIYK
KVRKDLLDNGLVYSLFLYLATLGTFLLSFYAAVRSEYAVGATAAPKRLIMELLTTVAWPP
MLHIGYLTISNLWVPVGYLLRCPEYPERRFMMAVNDRGIFFPQADVQMKLLHQTRPALGS
YQHYILVPFVLAAILVAASVLSLGYNT

Enzyme Prediction     

No EC number prediction in GAQ12271.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	105	336	2.4e-20	0.991304347826087

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	8.95e-92	105	341	1	233	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
224136	BcsA	6.51e-35	90	419	39	366	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
236918	bcsA	6.20e-27	61	340	231	490	cellulose synthase catalytic subunit; Provisional
133045	CESA_like	8.88e-23	109	294	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
133059	CESA_CaSu_A2	1.55e-22	105	337	1	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA14290.1|GT2	0.0	1	618	1	619
BCS12365.1|GT2	2.42e-255	1	615	1	608
BCS00600.1|GT2	2.42e-255	1	615	1	608
AMW91838.1|GT2	2.89e-255	73	442	1	370
QRD81189.1|GT2	1.16e-245	1	574	1	568

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	4.16e-27	102	340	125	377	Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	4.77e-27	102	340	137	389	Chain A, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	4.78e-27	102	340	138	390	Chain A, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7LBY_A	3.51e-24	105	340	273	503	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P58932|BCSA_XANAC	5.26e-28	105	340	153	383	Cellulose synthase catalytic subunit [UDP-forming] OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsA PE=3 SV=1
sp|Q9WX75|BCSA5_KOMXY	9.87e-28	105	413	146	449	Putative cellulose synthase 3 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-B PE=3 SV=1
sp|Q9RBJ2|BCSA4_KOMXY	9.87e-28	105	413	146	449	Putative cellulose synthase 2 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-A PE=3 SV=1
sp|P58931|BCSA_PSEFS	1.24e-26	105	358	159	404	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2
sp|Q8Z291|BCSA_SALTI	2.48e-24	105	340	273	503	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhi OX=90370 GN=bcsA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000019	0.000005

TMHMM  Annotations     

Start	End
28	50
359	381
396	418
490	512
540	562
603	625