CAZyme Information: GAQ12250.1

Basic Information

• Species: Aspergillus lentulus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus lentulus
• CAZyme ID: GAQ12250.1
• CAZy Family: GT71
• CAZyme Description: endo-chitosanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
242		25241.65	4.0308

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlentulusIFM54703	9916	N/A	259	9657

• Gene Location: location=BCLY01000017:1718849-1719675(+)

Full Sequence      

MRYLATATILAGAGLASAYSVPANLQQIYNKHKSGTCQNKLQDGFSDGISGSGSFAYCGD
IQGAIFLHSSANGGQYDNMDIDCDGANNSAGDCANDPSGQSMTAFMDTVKQYGISDLDAN
IHPYVVFGNSGSSPTFDPQQYGMEPLSVMAVVCNNQLFYGVWGDTNGGTSTGEASISLAK
LCFPNDGITGDNGHGEEDVLYIGFTGQDAVPGASAAWTARDTQTFEESIKSLGDRLVAKL
SA

Enzyme Prediction     

EC	3.2.1.132:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH75	14	238	9.8e-84	0.95

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399960	Glyco_hydro_75	4.48e-103	79	239	1	165	Fungal chitosanase of glycosyl hydrolase group 75. This family consists of several fungal chitosanase proteins. Chitin, xylan, 6-O-sulphated chitosan and O-carboxymethyl chitin are indigestible by chitosanase. EC:3.2.1.132. The mechanism is likely to be inverting, and the probable catalytic neutrophile base is Asp, with the probable catalytic proton donor being Glu. (see the Chitosanase web-page from CAZY).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJG44374.1|GH75	2.79e-165	1	242	1	242
AAS77607.1|GH75	2.33e-114	1	242	1	235
QYT03532.1|GH75	2.33e-114	1	242	1	235
UKZ81671.1|GH75	6.67e-114	15	242	15	235
UKZ55925.1|GH75	1.91e-113	15	242	15	235

PDB Hits     

GAQ12250.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WB37|CSN_ASPFU	3.12e-169	1	242	1	242	Endo-chitosanase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=csn PE=3 SV=1
sp|Q2U1H5|CSNB_ASPOR	6.88e-113	16	242	15	241	Endo-chitosanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csnB PE=3 SV=1
sp|Q2U3M5|CSN_ASPOR	5.51e-106	16	242	15	245	Endo-chitosanase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csn PE=3 SV=1
sp|Q9P961|CSN_ASPOZ	5.51e-106	16	242	15	245	Endo-chitosanase OS=Aspergillus oryzae OX=5062 GN=csn PE=1 SV=1
sp|Q875I9|CSN_ASPFM	5.03e-105	16	242	15	238	Endo-chitosanase OS=Neosartorya fumigata OX=746128 GN=csn PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000319	0.999650	CS pos: 18-19. Pr: 0.9793

TMHMM  Annotations     

There is no transmembrane helices in GAQ12250.1.