CAZyme Information: GAQ12235.1

Basic Information

• Species: Aspergillus lentulus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus lentulus
• CAZyme ID: GAQ12235.1
• CAZy Family: GT71
• CAZyme Description: Alpha-galactosidase [Source:UniProtKB/TrEMBL;Acc:A0A0S7EBZ8]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1101		124019.28	6.3886

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlentulusIFM54703	9916	N/A	259	9657

• Gene Location: location=BCLY01000017:1673025-1676882(+)

Full Sequence      

MDQLNLTHFEGAANTAYLAQSRVPNVIACNVILLSVVSIAVAVRLYVRYRYYRIRSDDDV
HVCTLFYLNVEYGSFSLISPDSNMGLVTRYGYGRHFELIADQPSTITMFLKLVFVTQLVY
IIALNTIKVSFCVLYMHIFIPSRVLTSLCIALIILLIMECVEEIIVVILQCRPVQAAWDP
TITGRCLNITLFYYISFGIKLATDIAIFVLPIPPLLRLRVRGLQKFGVILMFALGLLVCV
TSIIRVTYIKNFSPDHTWFLVAPLNWSAVEVCVAIFISCLPSLKTLITLHWHIPSLVASR
NRDSTTDPLSTRICTFFMGRGKEADHERHMSPDGTARHDIPLSENHPIGAILAGICPADI
CPSLNTIPQAKEIPEAPVTRLINPDMPSQTITLESQALRVKVLIDKDGAAFLKEVLPLPG
TSPTPAFKNFSDSYAPLVEVRLAGEGTERNKSSKSLVGSYVGARLRYQSHEIDTAADSQT
LHVRLQDGISGALVTSHLTIYEEFPVLRATASIQNGGDKDLVVTQLTSLVLGGLSTSSER
WWHEYRLSVPNNSWFREAQWVEHDLPSLGVDDCGVYGRPDEHWGSLTHYSVSNRGTFSTE
GHLPMGLLKHVSGKDTWLWQVENNGSWRWEIGDWKDSIYLAAGGPVETEHDWRERLAPGQ
EFTTVPVALCHVQDDYEKAFAAMTQYRRQIRRKHRDHDRLPIIFNDYMNCLMGDPTEEKV
LALVDPVVKAGAEYFVIDAGWYADDSGWWDDVGLWEPSQKRFPSGFKELLSQIRNKGLIP
GLWIEPEVIGVRSVVAKQLPDEAFFQRDGHRILEKNRYQLDYRHPTVREHMSAVIHRLVT
EYGVGYFKFDYNIDVTQGTDINCSSPGSGQLEHNRAYLHWVNELHDRYPHLLIENCSSGA
QRMDYAMLAVHALQSSSDQQDPERYPAIASALPTAVTPEQGAIWAYPQPAWDDELNAMTV
VNSLLGRVHLSGRLDLLRPEQFDLIKDGMDVYRAIRADLPTATAFWPLGLPQWHDDWFSL
GMAVTKRDVNGRECYYLSIWRRGGPESIDLPVKALCGRAVNAEILYPTRLPAMIEWLSNK
GLLKVTISSEMGARLVKLTAE

Enzyme Prediction     

No EC number prediction in GAQ12235.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	463	1003	8.2e-99	0.7688953488372093

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269892	GH36	8.06e-91	699	994	1	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
307952	Melibiase	8.23e-38	678	937	14	295	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
225882	GalA	2.92e-29	466	996	85	586	Alpha-galactosidase [Carbohydrate transport and metabolism].
269893	GH27	2.50e-09	704	778	5	80	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
407116	Glyco_hydro_36N	2.55e-08	464	531	73	154	Glycosyl hydrolase family 36 N-terminal domain. This domain is found at the N-terminus of many family 36 glycoside hydrolases. It has a beta-supersandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE64621.1|GH36	0.0	389	1100	5	716
QMW46905.1|GH36	0.0	378	1100	52	773
QRD91154.1|GH36	0.0	378	1100	52	773
QMW34832.1|GH36	0.0	378	1100	52	773
UDD63863.1|GH36	0.0	389	1100	5	716

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XN0_A	1.23e-29	477	904	133	538	Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN0_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN1_A Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_C Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_D Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM]
4FNR_A	1.60e-29	425	921	77	551	Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_B Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_C Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_D Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
2XN2_A	1.62e-29	477	904	133	538	Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with galactose [Lactobacillus acidophilus NCFM]
4FNQ_A	2.12e-29	425	921	77	551	Crystal structure of GH36 alpha-galactosidase AgaB from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNT_A	6.49e-29	425	908	77	538	Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_B Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_C Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_D Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G1UB44|MELA_LACAC	6.31e-29	477	904	133	538	Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
sp|Q9ALJ4|AGAA_GEOSE	8.25e-29	425	921	77	551	Alpha-galactosidase AgaA OS=Geobacillus stearothermophilus OX=1422 GN=agaA PE=1 SV=1
sp|P43467|AGAL1_PEDPE	1.27e-26	472	947	126	569	Alpha-galactosidase 1 OS=Pediococcus pentosaceus OX=1255 GN=agaR PE=3 SV=1
sp|Q5ARP5|AGALG_EMENI	2.50e-21	466	921	102	550	Probable alpha-galactosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aglG PE=2 SV=1
sp|P27756|AGAL_STRMU	3.25e-21	430	921	78	544	Alpha-galactosidase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=aga PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000001

TMHMM  Annotations     

Start	End
25	47
118	140
150	169
190	212
227	249
256	278