CAZyme Information: GAQ12126.1

Basic Information

• Species: Aspergillus lentulus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus lentulus
• CAZyme ID: GAQ12126.1
• CAZy Family: PL38
• CAZyme Description: mannosyl phosphorylinositol ceramide synthase CSH1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
331		37724.46	8.7111

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlentulusIFM54703	9916	N/A	259	9657

• Gene Location: location=BCLY01000017:1348662-1349755(+)

Full Sequence      

MARYRLRLLLTLLLVLLFGGLFSSSFQQLYYLLRLPFVWEASSAAAVISQEHDQFDVTFA
AYEANYSSADAGPAPLIPPILHHIHLGSRPPRAEWLEARKLCLKHHTSWSTFIWNEDSAE
KLVREEFPHLHDMWKSYPYMIQRVDALRYMILQKHGGEFTPRECDGADSSGVILDYDLAC
KRSLEPLRQFDFVAPAAHPTGFSIGMMLSSPGNPYIKALVDDLPLYNHRWLYLPYVTVMF
STGCHYASTIYTLQSNRSSLRILSGPPDAPRMHMLNGQVNTPLFRHLGSSSWHNRDARLI
SLFKNLDQRALFAIGRVDVAALRMKSKAQLS

Enzyme Prediction     

No EC number prediction in GAQ12126.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	3.52e-18	29	243	29	232	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	7.33e-09	94	187	3	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD65563.1|GT32	7.72e-145	23	313	23	299
QRD92706.1|GT32	1.27e-143	23	313	23	299
QMW36301.1|GT32	1.27e-143	23	313	23	299
QMW48357.1|GT32	7.29e-143	5	313	5	299
CAK44892.1|GT32	2.90e-131	1	314	1	300

PDB Hits     

GAQ12126.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38287|CSH1_YEAST	4.30e-30	73	305	58	272	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	6.38e-29	70	305	47	264	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	1.07e-26	77	312	57	272	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	3.68e-23	77	312	64	281	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q9UT67|IMT2_SCHPO	1.30e-21	70	300	75	289	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.941627	0.058380

TMHMM  Annotations     

Start	End
9	31