CAZyme Information: GAQ11885.1

Basic Information

• Species: Aspergillus lentulus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus lentulus
• CAZyme ID: GAQ11885.1
• CAZy Family: GT32
• CAZyme Description: Zn(2)-C6 fungal-type domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A0S7E2M7]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
858	BCLY01000017|CGC15	93354.87	9.1814

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlentulusIFM54703	9916	N/A	259	9657

• Gene Location: location=BCLY01000017:489840-493865(-)

Full Sequence      

MEKPIASSQNRRRQCWECHRRRLVCDFSLPGCRKCYTAGVECPGYDDKKPLKWVTTGEVT
SRPRKKTVQQSTAKQHASEDRSDSQDEVWSLSVPRDRLVTESGAIVEAAYYFNTCILPEY
TCLLRLAENAFITAFPMESLPAIPPSIHCTLVSLALSHRFHRLLPRNSRSDLREIEAKHY
QHRGQAIQYLKEEIGRPDKCRTDKTLVGVMMLLLSDSRQSTSPNWRHHFTAALEMITLRG
GVEKVLHSAPHLKALLLIGIISNTTSPPSDHIPLGSDVRSIEVISLMYGGGFFPVLLCPP
ALLANIIQINHLRLQAFSQPSTESEGRALALLGRITAFSPEQWAMSCAAPEMGIILGHVY
RSAVILYCILSLQSLCVLPRTAQLRSLTVTHAKELFAYLKQACGAPGIGKCMLWPLIVAA
VCARGDLDMQQFVHRQLSALGTDIGTPLPLLAAVVFRNFWETPLAAAQIYSFSPATDIVY
SVVVPESTASSNSGPIYFQIRAPTSYQWVALGQGSQMAGSNMFIMYAASVNNVTLSPRSG
RGRFPPGYNPDAQIELLNGTGISNGYMTANVRCNNCLQWTGGSLDPSSSSSSWIWAEKQG
TAIDSSDPRYAITRHDSHGVHTISMSQARVANVDALNPFASQNAASTPQTVTAGTTASKS
NSILIAHAVLMSVAFVIFFPSFAISVHIIPYSKTVSRIHAPLQLFTLAMALAGLGLGVYL
GVDTNQMDKYHPIIGLVVVGMLVLFQPLMGLLQHMHFRRSGGKSLFAYVHRWLGRILIAL
GIINGGLGFLLTKNTGQPAPKGAIIAYSVVAGVVGLAYIIFVIVLPFTSKKSAAPQKVAS
SNGSGEGIAVQERNGASD

Enzyme Prediction     

EC	1.1.99.18:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA8	473	633	1.9e-20	0.9065934065934066

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
187688	CDH_like_cytochrome	2.72e-61	463	625	5	168	Heme-binding cytochrome domain of fungal cellobiose dehydrogenases. Cellobiose dehydrogenase (CellobioseDH or CDH) is an extracellular fungal oxidoreductase that degrades both lignin and cellulose. Specifically, CDHs oxidize cellobiose, cellodextrins, and lactose to corresponding lactones, utilizing a variety of electron acceptors. Class-II CDHs are monomeric hemoflavoenzymes that are comprised of a b-type cytochrome domain linked to a large flavodehydrogenase domain. The cytochrome domain of CDH and related enzymes, which this model describes, folds as a beta sandwich and complexes a heme molecule. It is found at the N-terminus of this family of enzymes, and belongs to the DOMON domain superfamily, a ligand-interacting motif found in all three kingdoms of life.
176490	Cyt_b561_FRRS1_like	3.27e-41	640	823	12	191	Eukaryotic cytochrome b(561), including the FRRS1 gene product. Cytochrome b(561), as found in eukaryotes, similar to and including the human FRRS1 gene product (ferric-chelate reductase 1), also called SDR-2 (stromal cell-derived receptor 2). This family comprises a variety of domain architectures, many of which contain dopamine beta-monooxygenase (DOMON) domains. The protein might act as a ferric-chelate reductase, catalyzing the reduction of Fe(3+) to Fe(2+), such as associated with the transport of iron from the endosome to the cytoplasm. It is assumed that this protein uses ascorbate as the electron donor. Belongs to the cytochrome b(561) family, which are secretory vesicle-specific electron transport proteins. Cytochromes b(561) are integral membrane proteins that bind two heme groups non-covalently, and may have six alpha-helical trans-membrane segments.
406418	CDH-cyt	8.77e-33	472	632	14	177	Cytochrome domain of cellobiose dehydrogenase. CDH-cyt is the cytochrome domain, at the N-terminus, of cellobiose dehydrogenase. CDH-cyt folds as a beta sandwich with the topology of the antibody Fab V(H) domain and binds iron. The haem iron is ligated by Met83 and His181 in UniProtKB:Q01738.
403235	Fungal_trans_2	1.23e-21	111	441	5	340	Fungal specific transcription factor domain. This family of are likely to be transcription factors. This protein is found in fungi. Proteins in this family are typically between 454 to 826 amino acids in length. This protein is found associated with pfam00172.
214769	B561	3.25e-09	667	789	2	129	Cytochrome b-561 / ferric reductase transmembrane domain. Cytochrome b-561 recycles ascorbate for the generation of norepinephrine by dopamine-beta-hydroxylase in the chromaffin vesicles of the adrenal gland. It is a transmembrane heme protein with the two heme groups being bound to conserved histidine residues. A cytochrome b-561 homologue, termed Dcytb, is an iron-regulated ferric reductase in the duodenal mucosa. Other homologues of these are also likely to be ferric reductases. SDR2 is proposed to be important in regulating the metabolism of iron in the onset of neurodegenerative disorders.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7013938.1|AA8	1.81e-78	465	840	18	395
SMR42136.1|AA0	7.04e-73	465	840	19	398
SMR44317.1|AA0	7.04e-73	465	840	19	398
SMR55355.1|AA0	6.53e-66	475	842	22	375
SMR57731.1|AA0	6.53e-66	475	842	22	375

PDB Hits     

GAQ11885.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|E5AE39|C6TF_LEPMJ	1.47e-69	3	464	35	494	Phomenoic acid biosynthesis cluster-specific transcriptional regulator OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) OX=985895 GN=C6TF PE=4 SV=1
sp|S0EFU6|BEA4_GIBF5	5.20e-06	15	53	19	55	Beauvericin cluster-specific repressor BEA4 OS=Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831) OX=1279085 GN=BEA4 PE=3 SV=1
sp|P78704|ACR2_NEUCR	8.72e-06	2	67	9	76	Acriflavine sensitivity control protein acr-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=acr-2 PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000001

TMHMM  Annotations     

Start	End
663	685
698	720
730	752
773	792
802	824