CAZyme Information: GAQ11792.1

Basic Information

• Species: Aspergillus lentulus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus lentulus
• CAZyme ID: GAQ11792.1
• CAZy Family: GT31
• CAZyme Description: probable pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
324		34760.99	7.9183

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlentulusIFM54703	9916	N/A	259	9657

• Gene Location: location=BCLY01000017:224843-225936(+)

Full Sequence      

MHLPSLLLSLLGFGLMASASPIEGRSDRSKAPAGCLTVGSSGKYSTIGAALNALGTSTSD
ACIFISAGTYKEQLTISYKGKLTMYGETTDTSSYKKNKVTITHTISSPQAGTLDKSATVN
VRSDGFKMYNINVINGYGKGSQAVALVASADKLGFYGCSFVGYQDTLYAKAGHQYYSNCY
IEGATDYIFGDASAWFGECDIMSVGAGYITAMSRTTSAETTWYAFDHCNIYGKSGVDLTG
KVYLGRPWRVLARVIYQNSQLSNIINPKGWTTMAEGATPLYYEYNNKGAGADTSKREYES
SISGAVSMNTVLGSGWNSWIDTTY

Enzyme Prediction     

EC	3.1.1.11:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	40	298	1.4e-84	0.8993055555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395871	Pectinesterase	1.70e-59	41	296	9	271	Pectinesterase.
215357	PLN02665	1.60e-53	41	316	77	359	pectinesterase family protein
178372	PLN02773	8.01e-50	31	296	2	275	pectinesterase
178051	PLN02432	5.34e-49	29	316	6	291	putative pectinesterase
178113	PLN02497	2.16e-47	42	316	42	325	probable pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABF50865.1|CE8|3.1.1.11	1.52e-164	7	324	9	325
EAA63358.1|CE8|3.1.1.11	1.52e-164	7	324	9	325
EHA20167.1|CE8	5.43e-163	1	324	1	327
ALI87001.1|CE8|3.1.1.11	5.43e-163	1	324	1	327
CAK47976.1|CE8	5.43e-163	1	324	1	327

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1E_A	1.32e-162	27	324	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	1.87e-162	27	324	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
1XG2_A	6.74e-31	42	296	13	274	Chain A, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	1.89e-30	41	296	16	278	Pectin methylesterase from Carrot [Daucus carota]
2NSP_A	5.97e-17	44	313	18	335	Chain A, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DBT4|PMEA_NEOFI	2.15e-217	1	324	1	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	2.01e-206	1	324	1	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|Q4WBT5|PMEA_ASPFU	2.01e-206	1	324	1	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|Q5B7U0|PMEA_EMENI	2.70e-165	7	324	9	325	Pectinesterase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pmeA PE=1 SV=1
sp|A2QK82|PMEA_ASPNC	9.65e-164	1	324	1	327	Probable pectinesterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000224	0.999746	CS pos: 28-29. Pr: 0.4687

TMHMM  Annotations     

There is no transmembrane helices in GAQ11792.1.