CAZyme Information: GAQ11721.1

Basic Information

• Species: Aspergillus lentulus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus lentulus
• CAZyme ID: GAQ11721.1
• CAZy Family: GT22
• CAZyme Description: Alpha-L-rhamnosidase [Source:UniProtKB/TrEMBL;Acc:A0A0S7E6N3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
914	BCLY01000017|CGC8	101933.43	6.1234

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlentulusIFM54703	9916	N/A	259	9657

• Gene Location: location=BCLY01000017:38612-41356(+)

Full Sequence      

MAEIIALRFEHHPSGLGVHSSSPRISWTFSAIDESIRDWKQCQYEIAVQRQTGLPAHLVV
QSAESSLVAWPSTPLQSREQAQVRVRVRGSWMDRATGCAHSDWSAWSSWATVECSLLSSQ
DWTAMPISSPSVLVSPQEPLRPLLFRKAFVLPSAFGSVYHARLYITAFGVYRAYLNGTQI
GDHEMAPGWTSYHHRLAYQVFDVGSLITTKGDNVLCIEVAEGWFAGRLGFGGGRRYIYGD
RIAVMAQLEVGGLAADRFQVVSDESWKCHPSPIVSSEIYNGEIYDARADVGDWNQHGPLY
IDADWETVSVLAFPRARLYAPNAPPARITDQLTPKRLFTTPSGRKIVDFGQNLVGKLLIH
SMTLPVNATVTFTHAEVMEDGELGTRPLRGAQSVDTVVSSGRPLIDWSPKYTFHGFRFVQ
VDGWDPETEQFWQTNIRALVIHTDFKRTGRFECSNMAINQLHQNACWSMRGNFLSIPTDC
PQRDERLGWTGDIQVFGPSATFLYDCIGMLSEWLEDVACEQSEHYGVPPLVVPNVLDQVW
PSIPQALWGDVVIILPWILFLSSGDRDILHRQYASMSSWLNQGVRRGQDGLWDPELWQLG
DWLDPQAPPDEPGDCRTSGALVADAYLVHVTSRMADIASVLERKTESTHYSCKAQRLRAL
FQDRYITHSGLIVGDSQTAYSLAIVFGLLSTKHQLDTASRQLAARVRMAKFRVATGFAGT
PIILRALTDTDNLSLAYRMLLEDHCPSWLYPITMGATTIWERWDSMLPNGSINPGEMTSF
NHYALGSVVSWLHETVGGLRPLHAGWQTTLVSPQPGGSLTHAAVLYESVYGLWSCQWKVV
HDEDRDGAVILCLDLVVPPNCQAVVKVRTAEDGSSSLEENVGSGNHRWKVPFCPWLWPPQ
ATAPFITNPGQNVN

Enzyme Prediction     

EC	3.2.1.40:1	3.2.1.40:8	3.1.1.73:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	338	866	1.5e-151	0.9940476190476191
CBM67	139	314	1e-27	0.8977272727272727

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	2.59e-143	446	796	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
400715	Bac_rhamnosid_N	1.16e-57	161	330	6	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
336149	Bac_rhamnosid	3.51e-25	339	442	2	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	2.49e-12	798	882	1	78	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW33495.1|GH78	0.0	1	913	1	915
QRD94839.1|GH78	0.0	1	913	1	915
UDD62291.1|GH78	0.0	242	913	1	673
BCS09327.1|GH78	0.0	10	909	13	916
BCR96839.1|GH78	0.0	10	909	13	916

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GSZ_A	1.81e-254	4	890	4	865	Crystal structure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
3W5M_A	1.49e-143	146	890	306	1030	Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6I60_A	5.03e-103	144	867	178	898	Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q82PP4|RHA78_STRAW	5.65e-143	146	890	306	1030	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
sp|T2KNB2|PLH20_FORAG	6.53e-143	16	886	48	898	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
sp|P9WF03|RHA78_ALTSL	1.39e-125	16	890	44	910	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
sp|T2KPL4|PLH28_FORAG	6.49e-66	157	871	196	910	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000069	0.000000

TMHMM  Annotations     

There is no transmembrane helices in GAQ11721.1.