CAZyme Information: GAQ11704.1

Basic Information

• Species: Aspergillus lentulus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus lentulus
• CAZyme ID: GAQ11704.1
• CAZy Family: GT20
• CAZyme Description: dextranase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
335		36806.59	6.8245

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlentulusIFM54703	9916	N/A	259	9657

• Gene Location: location=BCLY01000016:4783531-4784649(-)

Full Sequence      

MRSFFSIGAFAISLVLPHQSNLTASTHCGTDLCTWWHETGEVKTNSAMAPDAVRQSRQYL
VQIMKLSGNDGNFPDDAGISIELDEGINMAWSRFEHSQDVDVRILRRDSQPVDVNVTIRP
TALTFDTQHVASSLVIRVSANQNGYQLSVEFPDDLFTYQSSGNAIQPRALVRFAFLPGDL
VPALGGPDTEVMTPGAFSLADIGGAPIVYFPPGVYWIDSEPLGLPRIRLDPSIYWVHLAP
GAFVKGAVEYTTANKDFYATGHDALSGEIWKVCRKYGHLKVLRKRNGSERASVFFCHANV
ADPRPRRALHSSERPNLSAGLSANRIAGSDYLLAK

Enzyme Prediction     

EC	3.2.1.11:4	3.2.1.57:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH49	26	270	1.4e-58	0.5009107468123861

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407501	Glyco_hydro_49N	2.77e-38	24	174	1	183	Glycosyl hydrolase family 49 N-terminal Ig-like domain. Family of dextranase (EC 3.2.1.11) and isopullulanase (EC 3.2.1.57). Dextranase hydrolyzes alpha-1,6-glycosidic bonds in dextran polymers. This domain corresponds to the N-terminal Ig-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR88901.1|GH49	2.70e-92	5	280	13	333
UBX54517.1|GH49	5.27e-64	1	268	1	319
AGM20695.1|GH49	2.89e-63	7	268	7	320
AXN77607.1|GH49	2.05e-60	17	268	14	312
CAB91097.1|GH49	3.45e-60	19	268	34	333

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1OGM_X	7.74e-62	23	268	4	299	Dex49A from Penicillium minioluteum [Talaromyces minioluteus],1OGO_X Dex49A from Penicillium minioluteum complex with isomaltose [Talaromyces minioluteus]
3WWG_A	5.14e-35	24	290	5	282	Crystal structure of the N-glycan-deficient variant N448A of isopullulanase complexed with isopanose [Aspergillus niger],3WWG_B Crystal structure of the N-glycan-deficient variant N448A of isopullulanase complexed with isopanose [Aspergillus niger],3WWG_C Crystal structure of the N-glycan-deficient variant N448A of isopullulanase complexed with isopanose [Aspergillus niger],3WWG_D Crystal structure of the N-glycan-deficient variant N448A of isopullulanase complexed with isopanose [Aspergillus niger]
1WMR_A	5.14e-35	24	290	5	282	Crystal Structure of Isopullulanase from Aspergillus niger ATCC 9642 [Aspergillus niger],1WMR_B Crystal Structure of Isopullulanase from Aspergillus niger ATCC 9642 [Aspergillus niger],1X0C_A Improved Crystal Structure of Isopullulanase from Aspergillus niger ATCC 9642 [Aspergillus niger],1X0C_B Improved Crystal Structure of Isopullulanase from Aspergillus niger ATCC 9642 [Aspergillus niger],2Z8G_A Aspergillus niger ATCC9642 isopullulanase complexed with isopanose [Aspergillus niger],2Z8G_B Aspergillus niger ATCC9642 isopullulanase complexed with isopanose [Aspergillus niger]
6NZS_A	1.03e-19	31	279	9	302	Dextranase AoDex KQ11 [Pseudarthrobacter oxydans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P48845|DEXT_TALMI	5.53e-60	23	268	38	333	Dextranase OS=Talaromyces minioluteus OX=28574 GN=DEX PE=1 SV=1
sp|O00105|IPUA_ASPNG	6.15e-35	10	290	6	297	Isopullulanase OS=Aspergillus niger OX=5061 GN=ipuA PE=1 SV=1
sp|P70744|DEXT_ARTGO	9.46e-20	31	279	60	353	Dextranase OS=Arthrobacter globiformis OX=1665 PE=3 SV=1
sp|P39652|DEXT_ARTSD	1.98e-17	31	268	60	338	Dextranase OS=Arthrobacter sp. (strain CB-8) OX=74565 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000773	0.999189	CS pos: 24-25. Pr: 0.7652

TMHMM  Annotations     

There is no transmembrane helices in GAQ11704.1.