CAZyme Information: GAQ11615.1

Basic Information

• Species: Aspergillus lentulus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus lentulus
• CAZyme ID: GAQ11615.1
• CAZy Family: GT2
• CAZyme Description: Bac_rhamnosid6H domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A0S7E333]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
655		71495.83	6.0262

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlentulusIFM54703	9916	N/A	259	9657

• Gene Location: location=BCLY01000016:4522571-4524585(-)

Full Sequence      

MRLLSFFVVAAAVCTAVPYEEYILAPATRDLIPKRVYHVNGSVSDPSALTNRKGGKATFH
GVSSVTYDFGHNIAGIVSLDISRVSSHDAFIGVTFSESSLWINNEACDATADAGLDSPLW
FPVGDGSGHYTAEKKHNRGAFRYLTLVTNTSATVVVESVRINFTAAPTQNLRAYTGYFHC
DDELLNRIWYAGAYTNQLCTIDPSMGNALPFLGTITSSDNITLPETVPWWSNDTIANGSS
VLTDGAKRDRLVWPGDMSIALESIAVSTYDLYSVRMALESLFAIQQADGRLPYAGKPFHD
TVSYTYHLHSLIGASYYYRYSGDKTWLAAHWSQYKRALQWSLSSIDDTGLANVTASADWL
RFGMGGHNIEANAILYFVLQESLALSQTLNDTTSSSTWSRIASTLKSSANARLWDPSAGL
YRDNETTTLHPQDGNAWALKSNLTLSFNQSSTISTALSARWGPYGAPAPEAGATISPFIT
GFELQAHFLADQPQRGLDLMRRQWGFMLDDPRMTQSTFIEGYSTDGSLHYAPYSNDARIS
HAHGWATGPTAALMFYAAGLQLVGAGGERWVFKPQLGDLRAVEAGFETRLGRFETEFKRG
SNGYTELVFTTPEGTTGDVKIDAEGALVSSNGTRVKLVDGVATGLHGDTWRLKSL

Enzyme Prediction     

EC	3.2.1.40:5

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	237	620	5.4e-70	0.7341269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	9.59e-12	175	443	3	237	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
225942	GDB1	2.97e-05	281	416	311	464	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
379972	Bac_rhamnosid_C	7.68e-05	559	634	1	78	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD83147.1|GH78	0.0	11	653	16	659
QMW28625.1|GH78	0.0	11	653	16	659
UDD56671.1|GH78	0.0	11	653	16	659
BAE58354.1|GH78	0.0	11	653	16	659
QMW40695.1|GH78	0.0	11	653	16	659

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	7.10e-12	65	591	194	670	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

GAQ11615.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000215	0.999742	CS pos: 16-17. Pr: 0.9817

TMHMM  Annotations     

There is no transmembrane helices in GAQ11615.1.