CAZyme Information: GAQ11182.1

Basic Information

• Species: Aspergillus lentulus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus lentulus
• CAZyme ID: GAQ11182.1
• CAZy Family: GT1
• CAZyme Description: Bac_rhamnosid_C domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A0S7E609]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1107		123023.32	4.6456

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlentulusIFM54703	9916	N/A	259	9657

• Gene Location: location=BCLY01000016:3192923-3197233(+)

Full Sequence      

MLGTTPQEQIIQAGLTNNPSLASWVNTARMDLTSNSRLYVALTTALFREMTRFHFLNVVL
SLLALVPVVLAQTCWRNTACSGPDGSAFEGPWEQGIYAPSSRFVRPKKVLPITNLNLDSS
YAQAMPVTLHGNGSLVIFDFGIEVGGIVTLNYTTSGSGALGLAFTEAKNWIGEWSDSSNG
AFKGPDGALYANFTQAGKGSYTMPDKALRGGFRYMTVFLVTNESIKVQIEDVSLEIGFQP
TWSNLRAYQGYFHSNDELLNRIWYSGAYTLQTNSVPVDTGRQVPMLHNGWANNATLGPGD
TIIVDGAKRDRAVWPGDMGIAVPSAFVSTGDLESVKNALQVMYNTQNTTTGAFDESGPPL
SQKNSDTYHMWTMIGTYNYVLFSNDTNFLSTNWQKYQAAMDFIYGKVDGKSGLLIVTGTR
DWARWQQGYNNSEAQMILYHTLKTGTQLAAWADSTSSLADTWNTRAENLKKAINQYCWDD
AYGAFKDNATATSLHPQDANSMALLFGIVNQTRATRISERLTDNWTPIGAVAPELPENIS
PFISSFEIQGHFAANQPTRALELIRRSWGWYLNNPNGTESTVVEGYLANGTFGYRSSRGY
SYDASYVSHAHGWSAGPTSALTNYVVGLSITSPGGMTWKIAPQFGDLKSAQAGFTTLLGK
YRASWKRNSKGYTLRFSAPKGTTGVLILPIVTSPKRPSIKIDGRDSKSGQIFLMACKDEA
QMPPRCCQPIPLAAARRHLSDEEIALYKLKFEEWRTVNRCYCPVSTCSGFIAPSYIQQQW
KNLVASSGFYRQLAASGATPSLPVSPLYISFPVLCPKCFAQVSDIDPELARTLENLGIKR
CPKCRAAVRRMFGCRHMQCRCGAQWCWYCCRAIEVCKANICAKGRAAEIDVRDDIAEEVA
TQIDEGEAGEEEDEEEDEDEDAEGDTDDEDYWDRYGGWRSDPDESDYEQDDQTAYEDEDD
ENQAPEMSLARAVQHSHFAAEAGSDVDLDARSDWEENSDFFGTEPDGSRLDPFDCNHDFA
MIIDKSEVENSEYEYECENCWRRIFPRETLIPGSLWEQIQSEDTSPTAQLIASMNVVERS
DSQMYLCRNCKFRLCGPCRAGYGNFEF

Enzyme Prediction     

EC	3.2.1.174:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	135	688	2.2e-98	0.9841269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	1.84e-11	250	523	4	253	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	7.47e-10	627	689	1	64	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
396187	IBR	0.003	838	869	18	52	IBR domain, a half RING-finger domain. The IBR (In Between Ring fingers) domain is often found to occur between pairs of ring fingers (pfam00097). This domain has also been called the C6HC domain and DRIL (for double RING finger linked) domain. Proteins that contain two Ring fingers and an IBR domain (these proteins are also termed RBR family proteins) are thought to exist in all eukaryotic organisms. RBR family members play roles in protein quality control and can indirectly regulate transcription. Evidence suggests that RBR proteins are often parts of cullin-containing ubiquitin ligase complexes. The ubiquitin ligase Parkin is an RBR family protein whose mutations are involved in forms of familial Parkinson's disease.
226800	COG4354	0.009	368	494	437	581	Uncharacterized protein, contains GBA2_N and DUF608 domains [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UCK57529.1|GH78	0.0	56	713	10	667
QRD88907.1|GH78	0.0	56	713	10	667
QMW37218.1|GH78	0.0	56	713	7	655
QMW25160.1|GH78	0.0	56	713	7	655
BAU45349.1|GH78|3.2.1.174	0.0	50	712	1	661

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	1.20e-16	136	648	194	659	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

GAQ11182.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999749	0.000254

TMHMM  Annotations     

Start	End
53	75