CAZyme Information: GAQ10343.1

Basic Information

• Species: Aspergillus lentulus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus lentulus
• CAZyme ID: GAQ10343.1
• CAZy Family: GH74
• CAZyme Description: glucan 1,3-beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1402	BCLY01000016|CGC11	154167.73	5.1686

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlentulusIFM54703	9916	N/A	259	9657

• Gene Location: location=BCLY01000016:528801-533520(-)

Full Sequence      

MARLHGLLPCEQKLILFLVILLYLLSPVYGSSHNHETLHHQHQKRQNGAEPSATAPTAVS
LPSVLPSSLSEAEKLIQKARQALSVMNKGRLAYPQRNTYQFQPDSLAFQPAPRLDYNNDG
PVGAADIRLNATKRSDEGSKQFMYTISPELAEAARLVAEASPLPLPGDYGIDIGKIIGQY
RVQKTNDTNIPQQQYLKPNGLDGYVSAVPTSKLAQERTELRKRAANDFWLTTMEQRGSSP
FAPAGYKVWRNVKDYGAKGDGVTDDTAAINKAISDGGRCGAECGSSTIYPAFIYFPSGTY
LVSSPIIQYYNTEFYGNPFDYPTILAASSFVGLGVITSDVYTGDNTQWYLNTNNFLRSIR
NFKMDITRTNPLAYVCAIHWQVAQGTSLENIIFYMMQDNITTQQGIYMENGSGGFLTNLT
FVGGNFGAYFGNQQFTTSHLSFMNCKTALQIHWDWAWTMQDVVITNCTNGIVIVGGAGGP
QSTGQSVGSLIILDAVIAFTKTGIVTSLFAENSTSFLLQNAAFISVDTAILDNVKSKTLM
SGGPYVTVESWGFGRVTSRTTSAFMNGQNIPAMNRSSALTRDGLVVPSFFQRGRPTYRDI
GMSQIIDVKAWGAAGDGKSDDTAVLNSILDRAANMSSIVFFPFGVYVIKDTLHIPLGSRI
IGQAWSQIMATGPKFQDEQNPRVAVQVGRSGDVGIIEIQSLMFTVSGPTAGAVLLEWNVH
ESSQGSAGMWGKFNIFTHFEEQKLTVPSEIDSHFRVGGAIGSDLQASNCPKKSGTVNEKS
YLENIWVWTADHDLDITSQEQIDVYAARGILVESQGPTWMYGTASEHHVLYQYQISEAKD
LFLSMIQTESPYFQPSPKAPTPFTAGLFPSDPTFSSCDAHSQTCAVSWALRILDSSSIYV
MGAGLYSWFSDYGQDCLVTANCQQRGVEISQSTDTWIYNLVTKGIVEMVSPVNENATLSA
ANVNGFMSSILAWIREGNSIIGKRKFPGFQLYEPEWLVGLNLTETCKTALTQKILCHSYL
EKFRSPVVGQYIENSTLANEVCDKGCGQSLKSWFDNVSTTCASQYINKAVATELGGYMYA
GYNLTCLKDPATGRYCPDIISHFTVVNNVASMTLFEMCSFCFTTMLQMRQASAYSPYSEK
DRFDLEQWVKPTCGLKGSTNLHDSLFLEELAPTPICLSNLTYTVQRGDTCDSIALKYQVA
SAAIQIGNPTLVYNCSELVAGRELCMPLNCGHQYMLQNNDTCYSIERAQSLWYGDVRKYN
PWINSECSNLQSTREVHGSIICLSPQGGLFNDTGSHPNLGATSPWSNTGYTQSTQYPPDG
FPVAKGTTLFCGRWHTVVRGDTCRSICIADGIPSTLFMDVNPSLSRTDCDGSLIEGTTYC
TGPDTHWDDTDFWDEDDYIILD

Enzyme Prediction     

EC	3.2.1.58:16	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	218	973	8.2e-260	0.9932432432432432

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403800	Pectate_lyase_3	7.10e-95	249	469	1	210	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
403800	Pectate_lyase_3	2.39e-07	605	720	1	124	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
197609	LysM	3.00e-07	1181	1225	1	43	Lysin motif.
396179	LysM	6.80e-06	1182	1227	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
212030	LysM	9.36e-06	1181	1224	2	43	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK47332.1|GH55	0.0	86	1395	1	1318
BCS21778.1|CBM50|GH55	0.0	52	1387	41	1362
CZS83162.1|GH55	0.0	47	1387	26	1351
EAA66649.1|CBM50|GH55	0.0	70	1398	60	1379
EAA67102.1|GH55	0.0	12	1387	12	1368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M5Z_A	6.20e-185	224	975	2	754	Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila],5M60_A Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila]
3EQN_A	3.02e-181	228	975	26	757	Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQN_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_A Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B0V1|E13B_ARTBC	8.34e-185	200	978	20	877	Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02077 PE=1 SV=1
sp|P49426|EXG1_COCCA	2.29e-148	228	970	48	781	Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum OX=5017 GN=EXG1 PE=1 SV=1
sp|P53626|E13B_TRIHA	4.88e-43	203	924	13	706	Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum OX=5544 GN=bgn13.1 PE=1 SV=1
sp|D4AVW3|LYSM5_ARTBC	2.91e-06	1000	1334	46	372	LysM domain-containing protein ARB_00327 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00327 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000298	0.999689	CS pos: 30-31. Pr: 0.9781

TMHMM  Annotations     

There is no transmembrane helices in GAQ10343.1.