CAZyme Information: GAQ10221.1

Basic Information

• Species: Aspergillus lentulus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus lentulus
• CAZyme ID: GAQ10221.1
• CAZy Family: GH71|CBM24|CBM24
• CAZyme Description: DUF2961 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A0S7DXU1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
455	BCLY01000016|CGC19	52097.79	5.9974

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlentulusIFM54703	9916	N/A	259	9657

• Gene Location: location=BCLY01000016:176396-177763(+)

Full Sequence      

MNSIGNHLLADITKQRVARSARVASWDQTGLNEDAFVVLPGETAVLADLEGPGAITHLWF
VQTCRKILGPGLIPYTKSGVAMMEIHNALGLNYEVSDPDYYRKVLIKMFWDDSETPNVLA
PIGDFFCLGHSMAANFQSLPFTVSVKPSEEKQFGGAAAFNCYLTMPFNKRARIEIENQND
EAYIQYFYIDYELYPEPLPQDTLYFHAHWRRENPTKGWAPSTIQTNSLETQVKNLDGKEN
YVILETTGAGHYIGCNHSVWHAQGTWWGEGDDMIFIDDDTWPPSMHGTGGEDYFSQGWGM
QKNAYPFCGTIIHEDDVPNTQVSYRWHLADPVRFSKRIKVTLETGHANHLRDDWSTTAYW
YQTLPGPKLEILPMEERLPRRPAVAAVPEPTEEELAALSADKKEKLKQHRERYDAFVMDR
KKWLARRAKESKERALSNVRICEDIRQRFLNSLKQ

Enzyme Prediction     

No EC number prediction in GAQ10221.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH172	101	362	1.2e-80	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402651	DUF2961	1.11e-115	102	362	1	234	Protein of unknown function (DUF2961). This family of proteins has no known function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX59927.1|GH172	2.18e-304	4	454	5	456
CAP93243.1|GH172	3.92e-291	4	455	3	454
CAK39208.1|GH172	9.15e-287	4	453	3	452
UPK94269.1|GH172	8.26e-282	2	454	5	457
QKD59092.1|GH172	8.42e-278	1	454	5	458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7V1V_A	9.42e-161	8	397	7	402	Chain A, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_B Chain B, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_C Chain C, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_D Chain D, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_E Chain E, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_F Chain F, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_A Chain A, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_B Chain B, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_C Chain C, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_D Chain D, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_E Chain E, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_F Chain F, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1X_A Chain A, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_B Chain B, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_C Chain C, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_D Chain D, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_E Chain E, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_F Chain F, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium]
4KQ7_A	5.90e-53	19	362	20	327	Crystal structure of a DUF2961 family protein (BACUNI_00161) from Bacteroides uniformis ATCC 8492 at 1.62 A resolution [Bacteroides uniformis ATCC 8492],4KQ7_B Crystal structure of a DUF2961 family protein (BACUNI_00161) from Bacteroides uniformis ATCC 8492 at 1.62 A resolution [Bacteroides uniformis ATCC 8492]

Swiss-Prot Hits     

GAQ10221.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000041	0.000001

TMHMM  Annotations     

There is no transmembrane helices in GAQ10221.1.