CAZyme Information: GAQ09972.1

Basic Information

• Species: Aspergillus lentulus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus lentulus
• CAZyme ID: GAQ09972.1
• CAZy Family: GH62
• CAZyme Description: glucan endo-1,3-alpha-glucosidase agn1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1336		146827.80	4.6561

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlentulusIFM54703	9916	N/A	259	9657

• Gene Location: location=BCLY01000012:4156041-4160166(+)

Full Sequence      

MLWCLLLLTIWLGCHKAHARAVFAHFMVTNSANYTISNWENDIKLAQDAHIDAFALNMAW
NDPTNDPSLVDAFNTANSLGFKLFFSLDYAGNGPWPVDEVLNLLGKFSSQSSYYRYQGKP
FVSTFEGPESADDWKLIKERTGAFFVPDYSSLGAKAAMELGVADGLFSWAAWPWGGQEMD
TYTDVSYRQYLESGMPYMMPASPWFYTNLPGYKKNWVWRGDNLWFDRWQEIMFVQPEFVE
IISWNDYGESHYIGPLYDKAMEAFDIGKAPYNYASGMPHDGWREFLPFLIDTYKSGQATI
NQESLMAWYRLHPVNACSDGGTTGNTASQLQLEFSPSRIFQDRIFYSALLGSQASVTVSI
GGASQEGGWDYVPDDNIGVYHGSVPTNGQTGQVIVTIHRSGATVAQMQGQAITTSCTQGI
QNYNAWVGSAKGGPVSATPSTKLTDRKCIRGTGANNFAGLCEYSCKYGYCPDACVCQAMG
APRKLPNATGITGYPLEGESPSYLGLCSFDCNYGYCPETACGTASAPLVTPTVSDFAPPA
CVAGTGEGNLAGLCSYACGFGYCPRSSCQCTNTGPLVVPPAMTGSAGFAAAGVDENIYGG
LCDFACKRGYCPSGACTSIAPEKPAPSGELYPNDGDYAVTGNAKGTRIFFNKKGKCTTDQ
KAFIKGAYDEFQILARREGVTKIDFNSIAASEYLSLAAKNKDQQAAIQDVFEYLSSVYPS
WLPTGFFNQYIYTRCDDPRHQCIDPCDPSKSSPTLAYTVNGGDYPYVNFCPRFFTYQKLA
DAIAYGKAGSGFERYDMTQYYRNRATVFYHEMCHVDQNINVPPNPHITDLMVTIEEMHGD
LPVHFPHKAYGPKFTKVLARFDGDILNSAGYYVQRNADNLAMYALASYVQEQLGNIYPAW
PIVTDKPFDPPYQGHNVIQYTINDGKVVFTNLGNDTAKADDCALSANVTSIADINKLIPS
WTYPSAYRKAKALWEEDLFPSKELENMKLRILPFGDSITVGTKSSDGNGYRKKLVLNLAE
NDVNMIGSVHAGSMSDNDNEGHADVTIQGLRSYSEVFENRPNVVLLHAGTNDMAGKSAVD
SAITELGELVDDIFNACPDTVLLMALIIPSSDNTVNDRINQFNGLAVQLVRKKFESGKHI
LLVDMNSFVTTDDLADGMNPNDRGYQIMADAWARGLQRANAMGWISDPITSVTTTVYTTV
HPTVTSTVVVTSAPDPTPTPVGYVYWFFGFEEMGDFPVFKIQGYGSSTSFDECKMRPEWE
ENNVVSMPKSLKGVTIQDDECDYAETNNWDQAAKSTQVGELVCSKFARAKCYKADVASLG
CPGGIFTLDAWTVCEW

Enzyme Prediction     

EC	3.2.1.59:2	3.2.1.59:6	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH71	22	407	1.2e-150	0.9946666666666667
CE3	989	1175	9e-51	0.9896907216494846
CBM24	448	521	2.9e-28	0.9736842105263158
CBM24	540	616	5.7e-26	0.9868421052631579

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397634	Glyco_hydro_71	0.0	22	406	1	372	Glycosyl hydrolase family 71. Family of alpha-1,3-glucanases.
211418	GH71	1.01e-127	17	296	2	283	Glycoside hydrolase family 71. This family of glycoside hydrolases 71 (following the CAZY nomenclature) function as alpha-1,3-glucanases (mutanases, EC 3.2.1.59). They appear to have an endo-hydrolytic mode of enzymatic activity and bacterial members are investigated as candidates for the development of dental caries treatments.The member from fission yeast, endo-alpha-1,3-glucanase Agn1p, plays a vital role in daughter cell separation, while Agn2p has been associated with endolysis of the ascus wall.
238871	XynB_like	6.38e-44	989	1176	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
211414	GH99_GH71_like	2.20e-39	22	290	1	283	Glycoside hydrolase families 71, 99, and related domains. This superfamily of glycoside hydrolases contains families GH71 and GH99 (following the CAZY nomenclature), as well as other members with undefined function and specificity.
238141	SGNH_hydrolase	1.74e-14	991	1174	1	186	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQK43472.1|GH71	1.73e-211	16	460	16	459
ATZ51352.1|CBM24|GH71	4.12e-210	19	546	19	553
QMW33048.1|CBM24|GH71	2.42e-205	20	504	79	567
QMW45081.1|CBM24|GH71	2.42e-205	20	504	79	567
QRD84612.1|CBM24|GH71	2.42e-205	20	504	79	567

PDB Hits     

GAQ09972.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13716|AGN1_SCHPO	1.42e-59	20	428	22	420	Glucan endo-1,3-alpha-glucosidase agn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=agn1 PE=1 SV=2
sp|B6GX22|MU71A_PENRW	1.23e-55	16	442	32	442	Mutanase Pc12g07500 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=PCH_Pc12g07500 PE=1 SV=1
sp|O94510|AGN2_SCHPO	4.50e-29	20	316	11	325	Ascus wall endo-1,3-alpha-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=agn2 PE=1 SV=2
sp|Q9RLB8|CESA_RUMFL	1.43e-08	989	1177	44	261	Multidomain esterase OS=Ruminococcus flavefaciens OX=1265 GN=cesA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000246	0.999705	CS pos: 19-20. Pr: 0.9715

TMHMM  Annotations     

There is no transmembrane helices in GAQ09972.1.