CAZyme Information: GAQ09683.1

Basic Information

• Species: Aspergillus lentulus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus lentulus
• CAZyme ID: GAQ09683.1
• CAZy Family: GH55
• CAZyme Description: dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
421		47675.77	9.9009

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlentulusIFM54703	9916	N/A	259	9657

• Gene Location: location=BCLY01000012:3290820-3292213(-)

Full Sequence      

MQLRTPPLSTMDLKHTLRDFCMNPRHTRWVAALLILGDAVLCALIIWKVPYTEIDWTTYM
QQISLYITGERDYTLIKGSTGPLVYPAAHVYIYNVLYHLTDEGRDIFLGQILFAILYLAT
LTVAMTCYKQAAAPPYLLVPLVLSKRLHSVFMLRLFNDGFAAFAMWVTILFFMNKKWTAG
VIVWSTGVAIKMTLLLLAPAIAVVLVLSLSLGPSIQLGFLAVLIQVLLGIPFLQNNPAGY
VSRAFELTRQFMFKWTVNWRFVGEELFLSRKFSLALLALHILLLGLFVATVWLKPSGLDL
PSFLQRFIQRRYRTVSLSKSFIMTAMLSSLAIGLLCARSLHYQFFAYLACATPFLLWQAG
FHPILVYVVWVAQEWAWNTYPSTNASSLVVILSLAAQVFGVLGVSFSRKHLEQSSQKEHL
Q

Enzyme Prediction     

EC	2.4.1.258:10

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT58	32	387	2.5e-146	0.9945054945054945

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398745	ALG3	0.0	32	387	1	358	ALG3 protein. The formation of N-glycosidic linkages of glycoproteins involves the ordered assembly of the common Glc3Man9GlcNAc2 core-oligosaccharide on the lipid carrier dolichyl pyrophosphate. Whereas early mannosylation steps occur on the cytoplasmic side of the endoplasmic reticulum with GDP-Man as donor, the final reactions from Man5GlcNAc2-PP-Dol to Man9GlcNAc2-PP-Dol on the lumenal side use Dol-P-Man. ALG3 gene encodes the Dol-P-Man:Man5GlcNAc2-PP-Dol mannosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR98022.1|GT58	1.71e-219	11	421	1	413
BCS10476.1|GT58	1.71e-219	11	421	1	413
BAE62911.1|GT58	1.70e-212	11	402	1	392
UDD58266.1|GT58	1.70e-212	11	402	1	392
QMW45188.1|GT58	1.07e-211	9	402	139	532

PDB Hits     

GAQ09683.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DDZ3|ALG3_NEOFI	9.21e-270	11	421	1	411	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=alg3 PE=3 SV=1
sp|Q4WVG2|ALG3_ASPFU	1.45e-268	8	421	6	419	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=alg3 PE=3 SV=1
sp|A1CBE6|ALG3_ASPCL	1.17e-229	8	421	60	472	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=alg3 PE=3 SV=1
sp|Q2U6A4|ALG3_ASPOR	3.02e-213	11	402	1	392	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=alg3 PE=3 SV=1
sp|A2RA94|ALG3_ASPNC	1.62e-195	11	421	1	409	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=alg3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000010	0.000004

TMHMM  Annotations     

Start	End
29	51
106	128
150	172
179	201
211	233
274	293
320	342
354	373
388	407