CAZyme Information: GAQ08654.1

Basic Information

• Species: Aspergillus lentulus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus lentulus
• CAZyme ID: GAQ08654.1
• CAZy Family: GH43
• CAZyme Description: endoglycoceramidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
501	BCLY01000012|CGC1	55599.92	6.0869

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlentulusIFM54703	9916	N/A	259	9657

• Gene Location: location=BCLY01000012:69277-70835(-)

Full Sequence      

MLFTPIAAASLLAVLGTQPAGVLAQDAEGWYKAHPGMARISQVNQDTHQIVDEFGRTRFF
HGTNVVMKEPPWYRPLEWAPGVSSFGEQDVQNLHDLGLNIVRLGHSWAGAEPVRGQYNQT
FLEIMKKQTKMAEDHGLYVLVDVHQDVLARQLCGHGVPDWFVKKDWVPGWKMFPFPLKLT
PFPVDNNGFPSPQSLCSTVDWSLSYTSVAVCNAFGRLYNNYDGLGDAFAAYWKKLASEYV
ETTNVVGYNLLNEPWVGDSMADPTLLVPGVADHKVLEGLWNRAAKQIRTVDNDTLIWFEG
ATIDILSGFNNVPLGDGSKSVHSFHYYSPPQLSSISTTLDNRRKDNERLRTAGVLTELTF
WMGDDKQMQGLADAMSVTDANMVSWIGWAYENLYNGTSGQPYPELAKHYSRAYPAAVAGT
PNSFSFDESSGTFKLQFTSEPSIKAPTEIILPPSTFPNGYKVQVLPDGSLLQYVVNKRTL
ALFTSTSIKNAIKISVTVSPR

Enzyme Prediction     

No EC number prediction in GAQ08654.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	59	390	2.6e-135	0.9969135802469136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408348	Glyco_hydro_5_C	1.44e-20	411	496	1	86	Glycoside hydrolase family 5 C-terminal domain. This is the C-terminal domain of endo-glycoceramidase II (EGC), a membrane-associated family 5 glycosidase pfam00150. The C-terminal domain assumes a beta-sandwich fold, which resembles that of many carbohydrate-binding modules.
395098	Cellulase	4.32e-09	51	390	1	268	Cellulase (glycosyl hydrolase family 5).
396834	Glyco_hydro_42	2.25e-05	87	156	13	96	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW30510.1|GH5_27	0.0	1	499	3	501
QMW42568.1|GH5_27	0.0	1	499	3	501
UDD59314.1|GH5_27	0.0	1	499	3	501
BAE60253.1|GH5_27	0.0	1	499	3	501
QRD89368.1|GH5_27	0.0	1	481	3	483

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5CCU_A	3.34e-29	35	495	36	475	Chain A, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S],5CCU_B Chain B, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S]
5J14_A	1.13e-28	35	495	36	475	Chain A, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S],5J14_B Chain B, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S],5J7Z_A Chain A, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S],5J7Z_B Chain B, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S]
2OSW_A	1.79e-25	52	500	39	479	Endo-glycoceramidase II from Rhodococcus sp. [Rhodococcus sp.],2OSW_B Endo-glycoceramidase II from Rhodococcus sp. [Rhodococcus sp.],2OYK_A Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like isofagomine complex [Rhodococcus sp.],2OYK_B Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like isofagomine complex [Rhodococcus sp.],2OYL_A Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like imidazole complex [Rhodococcus sp.],2OYL_B Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like imidazole complex [Rhodococcus sp.],2OYM_A Endo-glycoceramidase II from Rhodococcus sp.: five-membered iminocyclitol complex [Rhodococcus sp.],2OYM_B Endo-glycoceramidase II from Rhodococcus sp.: five-membered iminocyclitol complex [Rhodococcus sp.]
2OSX_A	3.26e-25	52	500	39	479	Chain A, Endoglycoceramidase II [Rhodococcus sp.]
6JYZ_A	3.15e-15	36	419	18	415	Chain A, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9GV16|EGCSE_CYANO	1.84e-89	43	480	34	483	Endoglycoceramidase OS=Cyanea nozakii OX=135523 PE=1 SV=1
sp|Q6L6S1|EGCSE_HYDVU	2.29e-83	43	467	25	454	Endoglycoceramidase OS=Hydra vulgaris OX=6087 PE=1 SV=1
sp|A0A3S5YBC7|EGCSE_RHOH1	2.93e-28	40	495	33	467	Endoglycoceramidase I OS=Rhodococcus hoagii (strain 103S) OX=685727 GN=REQ_38260 PE=1 SV=1
sp|H1AE13|EGCR1_ASPFM	7.67e-06	93	254	73	248	Glucosylceramidase OS=Neosartorya fumigata OX=746128 GN=egc1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000237	0.999728	CS pos: 24-25. Pr: 0.9685

TMHMM  Annotations     

There is no transmembrane helices in GAQ08654.1.