CAZyme Information: GAQ07554.1

Basic Information

• Species: Aspergillus lentulus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus lentulus
• CAZyme ID: GAQ07554.1
• CAZy Family: GH3
• CAZyme Description: mannan endo-1,6-alpha-mannosidase DCW1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
457		50735.34	4.6223

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlentulusIFM54703	9916	N/A	259	9657

• Gene Location: location=BCLY01000009:82481-84055(-)

Full Sequence      

MRLRSLYRCGATTLLLYEQVALADLGIQANDVDTLKSAAKMVAAPMMEFYDKNQTEGIPG
KLTGTWYVAGAMFMTLIQYWHASSDDTYNPIVSHDLMFQSGENYDFFSQNYSHWLGNDDQ
MFWGLASITASETGLPEIPGKPTWTSLARAVFNMQVARWDTTDCDGGMRWQIPLYLPGYT
MKNAISNGGLFELSARLARFTMNSTYAQWAEKIWDWSASTPLLQTNRWYIADSTSIEANC
KDAGNTQWSYNYGTYLSGASFMYNYTNGNEQWLERVNGLLNSLLGTFCPNDNGGNILSEV
ACEPIMTCDRNQIGFKGYTAMWLAHTAILVPSTATRIYPVLQGSALAISKQCSKQPGNTC
GIRWWQSTWDGFTPGLESQMAALGGITANLMYFKSTAPKTIDTNPDGKEDQIIATHEEET
TLDTLPPIGAADRAGAWILTVIIMVTAGGSVWWLVKT

Enzyme Prediction     

No EC number prediction in GAQ07554.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	30	396	6.8e-97	0.9497206703910615

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	7.42e-174	34	383	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW48345.1|GH76	1.08e-233	10	457	11	457
QRD92720.1|GH76	1.08e-233	10	457	11	457
QMW36289.1|GH76	1.08e-233	10	457	11	457
UDD65548.1|GH76	1.08e-233	10	457	11	457
BAE66452.1|GH76	1.54e-233	10	457	11	457

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	7.98e-79	28	403	26	415	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6FLP9|DCW1_CANGA	5.40e-90	20	455	14	445	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q5AD78|DCW1_CANAL	1.01e-88	27	455	21	451	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1
sp|P36091|DCW1_YEAST	7.25e-88	27	455	24	448	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|O74556|YCZ2_SCHPO	8.36e-88	25	391	20	385	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q75DG6|DCW1_ASHGO	3.20e-83	25	443	22	438	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001627	0.998339	CS pos: 23-24. Pr: 0.9693

TMHMM  Annotations     

Start	End
433	455