CAZyme Information: GAQ07474.1

Basic Information

• Species: Aspergillus lentulus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus lentulus
• CAZyme ID: GAQ07474.1
• CAZy Family: GH3
• CAZyme Description: SGNH_hydro domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A0S7DPU3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
431	BCLY01000008|CGC20	48389.34	6.8676

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlentulusIFM54703	9916	N/A	259	9657

• Gene Location: location=BCLY01000008:4902692-4904371(-)

Full Sequence      

MRALAFLLLFTWLFGASATILENGQARLNPYPGQTEVITLDKKTWRTYKPGVKEISYKGR
WDDKHISWWSAPGFKLAFTGERLALSFGQYTSQGVLVAYRLGGQDWQFSNVTANATYQFI
GPTTTGLNLTNAGDLRTGPMDTFPGSLDSRNLLTTSTIQLAGVSVAADAKISRVPEYPKM
VEIIGDSLSSGDYATYEGLSSWAYDFAAGLGNVEYSITVRSLPHLLHPILTNKAYPGICL
HDQNCWGNPRGQAYQWYRTSDTSWRAHEIYGDNPPRWNFAAQRAADLVVINIGTNDNNPT
NNVSSIDYYNDYVNLVGNIHKIWPKANIVLMSLWGGFGASGDTYVQGPIWVDEIKRVYQH
YEKQGFIHYFDTTGILQHNDIAPQWHPTDVGHIKIAAHLMQWVKLKFGWEFGATGPEVHH
GTLYWNDQANY

Enzyme Prediction     

No EC number prediction in GAQ07474.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	181	402	1.4e-21	0.9856459330143541

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238869	Endoglucanase_E_like	4.07e-52	180	404	1	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
238141	SGNH_hydrolase	4.82e-14	280	401	61	186	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404371	Lipase_GDSL_2	2.38e-12	183	392	1	174	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238865	sialate_O-acetylesterase_like1	8.82e-05	275	401	53	185	sialate O-acetylesterase_like family of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
225353	TesA	1.41e-04	276	404	69	209	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS17295.1|CE0	1.03e-203	17	431	15	400
QMW34907.1|CE0	1.46e-174	7	431	5	398
QMW46983.1|CE0	1.46e-174	7	431	5	398
QRD91240.1|CE0	1.46e-174	7	431	5	398
EAA62480.1|CE0	1.13e-151	6	431	5	307

PDB Hits     

GAQ07474.1 has no PDB hit.

Swiss-Prot Hits     

GAQ07474.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000210	0.999743	CS pos: 18-19. Pr: 0.9784

TMHMM  Annotations     

There is no transmembrane helices in GAQ07474.1.