CAZyme Information: GAQ06780.1

Basic Information

• Species: Aspergillus lentulus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus lentulus
• CAZyme ID: GAQ06780.1
• CAZy Family: GH2
• CAZyme Description: probable glucan endo-1,6-beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
400	BCLY01000008|CGC36	44900.07	4.9479

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlentulusIFM54703	9916	N/A	259	9657

• Gene Location: location=BCLY01000008:2602580-2603885(-)

Full Sequence      

MIRRLAALSALSGLATAWLPEVNKKITAANGTNLFTSSNGKIRGVNLGSQFVFEPWIAEK
AWSDMGCGGQKSEFDCVSSLGQAKANSAFASHWGSWITQDDIAEMVSYGLNTIRVPVGYW
MREDLVYSDSEHFPQGGLQYLENLCGWASDAGLYIIIDLHGAPGAQTPQNPFTGQYAPTA
GFYQDYQFERALKFLEWMTTNIHQNDKFRNVGMLEVVNEPVQDAGKVGSMRSSYYPNAFK
RIRAAEQSLNIDRNNYLHIQMMDRLWGSGDPNESLTDTYYAAYDDHRYLKWASVAVSKDS
YISTSCSDQLNSNTPTIVGEWSLSVPDNVQWNSDWSPDSNKDFYKKWFAAQVTAYEKQQG
WVFWTWKSQLGDYRWSYQDAVAAGVIPTDLNSLAGMKVCG

Enzyme Prediction     

EC	3.2.1.75:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	81	378	7.5e-151	0.9966666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	3.46e-24	41	379	17	374	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	3.76e-12	90	366	13	268	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR89699.1|GH5_15	7.91e-242	2	400	3	419
QKX60381.1|GH5_15	8.23e-221	2	399	1	410
QGA15346.1|GH5_15	2.36e-220	5	399	5	410
EAA59985.1|GH5_15|3.2.1.75	3.94e-214	14	399	13	409
ABF50867.1|GH5_15|3.2.1.75	3.94e-214	14	399	13	409

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	2.03e-37	39	400	6	392	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
3O6A_A	5.94e-37	39	400	11	397	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1CZ1_A	7.52e-37	39	400	6	392	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	8.39e-37	39	400	12	398	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
2PBO_A	2.23e-36	39	400	12	398	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DGM6|EXGB_NEOFI	7.73e-304	1	400	1	400	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgB PE=3 SV=1
sp|B0XRX9|EXGB_ASPFC	2.25e-286	1	378	1	378	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgB PE=3 SV=1
sp|Q4X1N4|EXGB_ASPFU	2.63e-285	1	378	1	378	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgB PE=3 SV=1
sp|Q0C8Z0|EXGB_ASPTN	8.55e-238	10	399	13	403	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgB PE=3 SV=1
sp|Q5B6Q3|EXGB_EMENI	7.01e-215	14	399	13	409	Glucan endo-1,6-beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000458	0.999509	CS pos: 17-18. Pr: 0.9669

TMHMM  Annotations     

There is no transmembrane helices in GAQ06780.1.