CAZyme Information: GAQ06774.1

Basic Information

• Species: Aspergillus lentulus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus lentulus
• CAZyme ID: GAQ06774.1
• CAZy Family: GH2
• CAZyme Description: alpha-N-acetylglucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
857	BCLY01000008|CGC21	98293.77	5.8562

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlentulusIFM54703	9916	N/A	259	9657

• Gene Location: location=BCLY01000008:2585720-2591164(+)

Full Sequence      

MDAKTKIIIKAVVIPLAFLILILTIVALFVLKCRRDRKKDEQENLNYSFAPYEQWQTPPQ
PHNQQWQAAQHSHNQWPMNQYPMATAQMEKSLVDYHPLGFAEGIDTNTAMVWVKALLLGL
CASTTFAQSLDGIYDLVRRRMPKHVDSFRFSLMDFNSTNNDQFVVSTAANGTILVQGNSL
SALSYGLHRYLADVAHVDIYWFVGSQLHLAPIPLPRLSKPLTGSSTVERRYHFNTVTFSY
TTAFWSWEDWELQLDWMALRGINLPLAWVGQEKILVEVFREIGLTDAETSSFLSGPAFQA
WNRFGNIQGSWGGDLPYSWIDSQFELQKKIVRRMVELGMTPVLPAFTGFVPRAISRVLPN
ATVVNGSRWGGFDERYTNDTFLEPFDPSFSRLQRSFIKKQQQAYGNITHIYTLDQYNEND
PYSGDLAYLRNVTHNTWLSLKSADPNAVWLMQGWLFYSNWDFWTDERVKAYLSGVEVDQD
MLVLDLFSESQPQWQRTQSYYGKPWIWCQLHDYGGNMGLYGQVMNVTVNATQALAASDSL
VGFGLTMEGHEGNEIMYDLLLDQAWSWQPIDTDRYFHNWVKTRYSSGVRGSAVPEELYQA
WDILRTTAYNNTNLTSTAVSKSIFELQPSISGLVNRTSHHPTTINYDPAALVQAWQLMDS
AASKDRSLWSQPAFLYDMVDITRQVMANAFIPMYINIVSTYQAGASVSKDGSNLIQLLYD
LDSVLSTNDNFRLSTWIQSARSWARNDAEADFYEYNARDQITLWGPKGEINDYASKQWGG
LVSSYYIPRWQKFLHYLENTQASKYNATKIEAQLLDFELKWQEETTKSTRAETRDLRSVL
AKVSRRWPSVFGDQNSP

Enzyme Prediction     

No EC number prediction in GAQ06774.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	170	843	3e-219	0.9924585218702866

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398659	NAGLU	0.0	230	566	1	332	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
404009	NAGLU_C	5.82e-94	575	825	1	242	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
404008	NAGLU_N	1.24e-24	131	215	1	81	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.
405743	TMEM154	7.19e-04	8	48	63	103	TMEM154 protein family. The function of this family of transmembrane proteins has not, as yet, been determined. However, it is thought to be a therapeutic target for ovine lentivirus infection. This family of proteins is found in eukaryotes and members are typically between 138 and 320 amino acids in length.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX62920.1|GH89	0.0	112	851	6	753
QGA19502.1|GH89	0.0	123	851	27	766
QGA20053.1|GH89	0.0	112	851	4	752
QKX57787.1|GH89	0.0	113	851	8	755
ATY61147.1|GH89	0.0	110	851	6	749

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XWH_A	8.72e-140	161	847	40	715	Crystal structure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]
2VC9_A	3.51e-105	128	798	169	825	Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	4.14e-105	128	798	177	833	Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	4.09e-104	128	798	192	848	CpGH89 (E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P54802|ANAG_HUMAN	4.03e-140	161	847	63	738	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2
sp|Q9FNA3|NAGLU_ARATH	2.75e-132	136	826	52	782	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999917	0.000119

TMHMM  Annotations     

Start	End
7	29