CAZyme Information: GAQ06333.1

Basic Information

• Species: Aspergillus lentulus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus lentulus
• CAZyme ID: GAQ06333.1
• CAZy Family: GH17
• CAZyme Description: cutinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372		35605.11	6.8459

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlentulusIFM54703	9916	N/A	259	9657

• Gene Location: location=BCLY01000008:1202932-1204100(+)

Full Sequence      

MKASVTTVVLLAGLAAGAPTKTIHSELEKRQFGTGTGTDGLGALASIFPILGGGGSSTSS
GLGALASIFPILGGGGSSTSSGLGALASLIPGLGGSSSSGSGFSLPGLSLPTSIPGLGNL
GSLGSSGSGSSGLSGLSGLGGLSGLNGLSASTTDSSAEASTSGTAATGSDSNSGVALSGL
LGDHIAKRALLGSITENGVKNKDACQPLTFIFARGTSELGNMGSIAGPPVATKLRSLLNN
KVVVQGVDYPASIEGNALLGAAGGPTMASLVKQALSQCPDTKVVVGGYSQGSMVVHNAAN
SLAEGQIAAAVLFGDPFKSQAVGKVPKAAVKEYCAAGDPVCLNGANVLAHLSYGDDAAEA
AQFLVTASGVKA

Enzyme Prediction     

No EC number prediction in GAQ06333.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	204	366	9.6e-42	0.9841269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	7.50e-43	204	365	1	170	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR89623.1|CE5	3.26e-84	195	370	103	278
QQK39777.1|CE5	5.07e-83	191	369	97	275
CAP91879.1|CE5	8.85e-79	192	369	144	321
QRD85183.1|CE5	1.45e-77	168	370	121	327
BAE58644.1|CE5	1.25e-76	196	370	36	210

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PSC_A	1.63e-33	186	365	64	244	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]
3GBS_A	8.65e-28	205	369	21	197	Crystal structure of Aspergillus oryzae cutinase [Aspergillus oryzae]
3QPD_A	6.75e-27	205	366	12	185	Structure of Aspergillus oryzae cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon [Aspergillus oryzae]
5X88_A	8.04e-21	185	354	5	184	Chain A, cutinase [Malbranchea cinnamomea]
7CY3_A	1.01e-20	205	369	17	194	Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9. [Paraphoma sp. B47-9],7CY3_B Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9. [Paraphoma sp. B47-9],7CY9_A Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9 solved by getting the phase from anomalous scattering of uncovalently coordinated arsenic (cacodylate). [Paraphoma sp. B47-9],7CY9_B Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9 solved by getting the phase from anomalous scattering of uncovalently coordinated arsenic (cacodylate). [Paraphoma sp. B47-9]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|C8VJF5|CUTI4_EMENI	2.48e-74	190	370	45	223	Cutinase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cut4 PE=2 SV=1
sp|Q00298|CUTI_BOTFU	2.48e-37	204	370	30	202	Cutinase OS=Botryotinia fuckeliana OX=40559 GN=cutA PE=1 SV=1
sp|Q8TGB8|CUTI_MONFR	1.38e-35	204	369	30	200	Cutinase OS=Monilinia fructicola OX=38448 GN=CUT1 PE=2 SV=1
sp|A8QPD8|CUTI1_TRIHA	4.83e-35	193	364	72	243	Cutinase cut1 OS=Trichoderma harzianum OX=5544 GN=cut1 PE=1 SV=1
sp|Q8X1P1|CUTI_BLUHO	3.70e-34	189	365	52	233	Cutinase OS=Blumeria hordei OX=2867405 GN=CUT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000599	0.999359	CS pos: 30-31. Pr: 0.6703

TMHMM  Annotations     

There is no transmembrane helices in GAQ06333.1.