CAZyme Information: GAQ06282.1

Basic Information

• Species: Aspergillus lentulus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus lentulus
• CAZyme ID: GAQ06282.1
• CAZy Family: GH16
• CAZyme Description: serine/threonine-protein kinase cds1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1515		171086.71	6.9154

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlentulusIFM54703	9916	N/A	259	9657

• Gene Location: location=BCLY01000008:1033083-1039127(+)

Full Sequence      

MEATQESTQPCTDPRRIGRNNSGLLEEDVSDIICILHPTSLAAHEAVAATASLAPQHILQ
KDELEYEDPDTAALDIALRLSSNVRNINLGFCFGRNRSRCDLLLAPDDNAKRISNTHFRI
HLTGDGILMLEDLSTNGTVVDDCRLRKNQKENSRMLTNGSVIQVLRGNNASDEVRFVVRI
PSRDGYAMRYTENMLRYLERVQRQPAGAMQKNRQGSVRPSLEWTVANAYGMHWTGGSMYN
VTGQIGKGAFATVYKLATKQHGAVYAAKELDKRRFMKNGILDQKVDNEMKIMKDLKHPNI
VQYIDHHEHDRWIYIIMEYVPGGELSTYLSTHGKIPEDMVKMLARQLLHALQYLHKRRIT
HRDIKPDNILIASLEPLRVKLSDFGLSKVVQEETFLKTFCGTLLYCAPEVYPEYENYRRG
EVRKRRRLGDPPPKTSPYDQSVDMWSFGAVLFHILSGTPPYTGRGDDRGSQMLRNIMTTD
PDYDVLRREGVSEAGVDFVRRLLNRDPHSRPKESECFQHSWIRDVPDVDEYDDNDIQPAD
FGALSDIGEDLENELDASQISLNDNPEPVLTGDESHDSNDLAQSKRPRIDHLPADIHYPS
LPNIESFPAARPIPETTPRRLFGEITSSALRSSNVFGASMNAFGGDDLSVHDFVSSTGES
IISDGNSLNSVLSLPDNPFAGSAPSLMGAENLVGQLNMNSWHPGTSAHGPPAATELPALK
TSVDEGVGGSPGPELNKETHPSTSTPKGAKFSRRIELPLPDTASERSSREITRENSKAPS
DKPEASAGEVFDIELAVTIDARTGRQISHPPEGIVSDTTSAALRHEMPTEIPPTISLHRH
EQPRPLLGKLTTLPGSIFDLTIRLEDRMTSWGRGPLATICHPDPMDTRIPAYALEVTFWA
PAIEAQIAAGRNWMEVPGVMAILSTKTRKCIWVNDTELRRGSEGSSTREGFHFGKLYTGD
IITIYRHRNKFLKFQCEFYHGDSARSRPEEEKGFVVRKVLMSKEGVAANRLPVRKDNDGG
KKQGINPKTSAIYENLRADLFTIFNLPDGLDTPMSLSRSPSPHPGGGWSSPGLTPGSGTS
TPRSGFLSPNSLGPSGISWAAARAKSDEVRGYPSFSTRNNGFFSRSKRKITSSLPRFRMN
GSARNGYVDKDEYWRGHNSSEAGLRFGFARGLMRRRRSRAFLALIVLVLGYLFFWTAIVQ
SYRRSSFGGGRKFVIILPSNVEGGVMEWKGAREWAIERNSISNKEEYAKRWGYELEIVNM
LAKKRYSHEWRESWEKVDIIRDAMRKYPNAEWFWWLDLNTWIMEYSYSLQDHIFDRLGEL
TYRDINLYNPLNISHPPTAPYLDELSRSAEGDGNPSSIELLLSQDCGGFNLGSFFIKRSL
WSDRLMDLWWDPVMYEQKHMDWEHKEQDALEYLYQSQPWIRSNVAFTPQRYINSFPPGAC
GEGGDPDVHYSVKDRDFMVNMAGCQFGRDCWGEMYLYRELSKKLNRTRWQRLKDGLGELY
SRLLPKEDKPQEQQQ

Enzyme Prediction     

No EC number prediction in GAQ06282.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	1212	1472	1.7e-85	0.983739837398374

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214567	S_TKc	4.33e-86	239	522	1	254	Serine/Threonine protein kinases, catalytic domain. Phosphotransferases. Serine or threonine-specific kinase subfamily.
270687	STKc_CAMK	2.30e-83	239	521	2	258	The catalytic domain of CAMK family Serine/Threonine Kinases. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. CaMKs are multifunctional calcium and calmodulin (CaM) stimulated STKs involved in cell cycle regulation. There are several types of CaMKs including CaMKI, CaMKII, and CaMKIV. CaMKI proteins are monomeric and they play pivotal roles in the nervous system, including long-term potentiation, dendritic arborization, neurite outgrowth, and the formation of spines, synapses, and axons. CaMKII is a signaling molecule that translates upstream calcium and reactive oxygen species (ROS) signals into downstream responses that play important roles in synaptic function and cardiovascular physiology. CAMKIV is implicated in regulating several transcription factors like CREB, MEF2, and retinoid orphan receptors, as well as in T-cell development and signaling. The CAMK family also consists of other related kinases including the Phosphorylase kinase Gamma subunit (PhKG), the C-terminal kinase domains of Ribosomal S6 kinase (RSK) and Mitogen and stress-activated kinase (MSK), Doublecortin-like kinase (DCKL), and the MAPK-activated protein kinases MK2, MK3, and MK5, among others. The CAMK family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.
368535	Glyco_transf_34	2.68e-80	1212	1470	4	238	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.
271000	STKc_Rad53_Cds1	3.11e-74	239	521	2	265	Catalytic domain of the yeast Serine/Threonine Kinases, Rad53 and Cds1. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. Rad53 and Cds1 are the checkpoint kinase 2 (Chk2) homologs found in budding and fission yeast, respectively. They play a central role in the cell's response to DNA lesions to prevent genome rearrangements and maintain genome integrity. They are phosphorylated in response to DNA damage and incomplete replication, and are essential for checkpoint control. They help promote DNA repair by stalling the cell cycle prior to mitosis in the presence of DNA damage. The Rad53/Cds1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.
270783	STKc_MAPKKK	5.75e-70	244	522	7	258	Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. MAPKKKs (MKKKs or MAP3Ks) are also called MAP/ERK kinase kinases (MEKKs) in some cases. They phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. This subfamily is composed of the Apoptosis Signal-regulating Kinases ASK1 (or MAPKKK5) and ASK2 (or MAPKKK6), MEKK1, MEKK2, MEKK3, MEKK4, as well as plant and fungal MAPKKKs. Also included in this subfamily are the cell division control proteins Schizosaccharomyces pombe Cdc7 and Saccharomyces cerevisiae Cdc15. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD89754.1|GT34	9.26e-233	1054	1508	1	458
QMW42907.1|GT34	9.26e-233	1054	1508	1	458
QMW30853.1|GT34	9.26e-233	1054	1508	1	458
UDD59694.1|GT34	9.26e-233	1054	1508	1	458
CAK42408.1|GT34	1.88e-231	1054	1508	1	457

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XZV_A	1.81e-62	85	524	60	468	Crystal structure of Rad53 1-466 in complex with AMP-PNP [Saccharomyces cerevisiae S288C],5XZV_B Crystal structure of Rad53 1-466 in complex with AMP-PNP [Saccharomyces cerevisiae S288C],5XZW_A Crystal structure of Rad53 1-466 [Saccharomyces cerevisiae S288C],5XZW_B Crystal structure of Rad53 1-466 [Saccharomyces cerevisiae S288C]
4PDP_A	5.27e-51	245	526	39	305	Crystal structure of Rad53 kinase domain and SCD2 [Saccharomyces cerevisiae],4PDP_B Crystal structure of Rad53 kinase domain and SCD2 [Saccharomyces cerevisiae],4PDS_A Crystal structure of Rad53 kinase domain and SCD2 in complex with AMPPNP [Saccharomyces cerevisiae],4PDS_B Crystal structure of Rad53 kinase domain and SCD2 in complex with AMPPNP [Saccharomyces cerevisiae]
3BHY_A	2.63e-44	239	525	7	272	Crystal structure of human death associated protein kinase 3 (DAPK3) in complex with a beta-carboline ligand [Homo sapiens],3BQR_A Crystal structure of human death associated protein kinase 3 (DAPK3) in complex with an imidazo-pyridazine ligand [Homo sapiens],5A6N_A Crystal structure of human death associated protein kinase 3 (DAPK3) in complex with compound 2 [Homo sapiens],5A6N_B Crystal structure of human death associated protein kinase 3 (DAPK3) in complex with compound 2 [Homo sapiens],5A6O_A Crystal structure of the apo form of the unphosphorylated human death associated protein kinase 3 (DAPK3) [Homo sapiens],5A6O_B Crystal structure of the apo form of the unphosphorylated human death associated protein kinase 3 (DAPK3) [Homo sapiens],5VJA_A Crystal Structure of human zipper-interacting protein kinase (ZIPK, alias DAPK3) in complex with a pyrazolo[3,4-d]pyrimidinone ligand (HS38) [Homo sapiens],5VJA_B Crystal Structure of human zipper-interacting protein kinase (ZIPK, alias DAPK3) in complex with a pyrazolo[3,4-d]pyrimidinone ligand (HS38) [Homo sapiens],5VJA_C Crystal Structure of human zipper-interacting protein kinase (ZIPK, alias DAPK3) in complex with a pyrazolo[3,4-d]pyrimidinone ligand (HS38) [Homo sapiens],5VJA_D Crystal Structure of human zipper-interacting protein kinase (ZIPK, alias DAPK3) in complex with a pyrazolo[3,4-d]pyrimidinone ligand (HS38) [Homo sapiens]
1YRP_A	3.11e-44	239	523	14	277	Catalytic domain of human ZIP kinase phosphorylated at Thr265 [Homo sapiens],1YRP_B Catalytic domain of human ZIP kinase phosphorylated at Thr265 [Homo sapiens]
2J90_A	4.68e-44	239	525	28	293	Crystal structure of human ZIP kinase in complex with a tetracyclic pyridone inhibitor (Pyridone 6) [Homo sapiens],2J90_B Crystal structure of human ZIP kinase in complex with a tetracyclic pyridone inhibitor (Pyridone 6) [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P50108|MNN10_YEAST	2.35e-106	1203	1491	112	389	Probable alpha-1,6-mannosyltransferase MNN10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN10 PE=1 SV=1
sp|P78817|YFE6_SCHPO	3.29e-85	1214	1492	76	343	Uncharacterized alpha-1,2-galactosyltransferase C637.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC637.06 PE=2 SV=2
sp|P22216|RAD53_YEAST	3.70e-59	85	526	60	470	Serine/threonine-protein kinase RAD53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD53 PE=1 SV=1
sp|Q09170|CDS1_SCHPO	2.68e-53	45	525	6	436	Serine/threonine-protein kinase cds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cds1 PE=1 SV=2
sp|Q54MH0|FHKD_DICDI	2.80e-44	239	524	199	474	Probable serine/threonine-protein kinase fhkD OS=Dictyostelium discoideum OX=44689 GN=fhkD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000000

TMHMM  Annotations     

Start	End
1180	1202