CAZyme Information: GAQ05911.1

Basic Information

• Species: Aspergillus lentulus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus lentulus
• CAZyme ID: GAQ05911.1
• CAZy Family: GH13|GH13
• CAZyme Description: Sialidase domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A0S7DTZ5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364	BCLY01000005|CGC4	40335.04	6.2774

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlentulusIFM54703	9916	N/A	259	9657

• Gene Location: location=BCLY01000005:1760331-1761425(-)

Full Sequence      

MPGHFGQKILKTFGLDDQRGSQPFQPQNDARLPGNRLINNDERLLSSEPSGTYPRLARLS
DGSILSAFTRFAGQTRILTVAKSTDGGRTFHDFGEVTRSQGDSDNLFLLEVAPSVVLGAF
RNHDLGPNGPTHFRITVCRSTDGGRSWQYASQAVEKSPPNGIWEPFMRLGRQGEVQLFYS
QEYAHDNQCTMLVRSFDQGSSWSQPECLEGINDRIRDGMTGIASTVDNGREALVMVFETT
RYGTFNLEALLSYDDGRTWGWRHEVYVPPRGHNAGAPQIASFADGSLAVIFMTDEDEQDV
QWTKNACIKMVFAGPPQDGRISWTRPTVICPHTSHWPGVLALDHHTLLAAYECGGPKGKT
VTLQ

Enzyme Prediction     

No EC number prediction in GAQ05911.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH93	50	309	2.4e-70	0.9055374592833876

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271234	Sialidase_non-viral	9.31e-10	114	358	26	329	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	1.30e-09	68	296	103	327	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	7.26e-04	46	150	194	296	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA62412.1|GH93	4.67e-198	1	364	1	367
QMW42642.1|GH93	2.07e-197	1	363	1	378
QMW30589.1|GH93	2.07e-197	1	363	1	378
QRD89469.1|GH93	2.07e-197	1	363	1	378
BAE60328.1|GH93	2.07e-197	1	363	1	378

PDB Hits     

GAQ05911.1 has no PDB hit.

Swiss-Prot Hits     

GAQ05911.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000040	0.000005

TMHMM  Annotations     

There is no transmembrane helices in GAQ05911.1.