CAZyme Information: GAQ05827.1

Basic Information

• Species: Aspergillus lentulus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus lentulus
• CAZyme ID: GAQ05827.1
• CAZy Family: GH135
• CAZyme Description: probable glucan 1,3-beta-glucosidase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
470	BCLY01000005|CGC5	54914.02	6.1118

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlentulusIFM54703	9916	N/A	259	9657

• Gene Location: location=BCLY01000005:1517175-1518766(+)

Full Sequence      

MATGILKVQGSKVVDSNGDEVLLRGAAIGGWMNMENFITGYTGHESQHRAAMRRVLGPEK
YEFFFDKWLEYFFTEADAKFFAGLGLNCIRIPFNYRHFEDDMNPRVLKETGFKHLDRVID
LCAKEKIYTILDMHTAPGGQNGDWHSDNPTSYAAFWDFKDHQDRTIWLWEQIAARYKNNP
WVAGYNPLNEPCDPEHVRLPAFYERVEKAIRAIDPDHILWLDGNTFAMEWKGFDKVLPNC
VYAMHDYSSMGFPTGERYKGTPEQKEHLERQYLRKAEFMNKNGTVIWNGEFGPVYANPRT
EAEAETINQERYSLLGEQLRIYDKYNIHWSIWLYKDIGLQGMIHTSPESKWNKTIQPLLE
KKKNFWLDAWGREPSAEPEAALRPLVDWIDKVSPTAKETYPTPWHTERHLLRNVFQTFLA
ASFVEEFAELFRGMDEKDLEALAHSFHFDECLQRGGLNEILREHARATKH

Enzyme Prediction     

EC	3.2.1.4:2	3.2.1.37:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	49	337	8.1e-131	0.9965034965034965

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	1.98e-26	70	336	22	270	Cellulase (glycosyl hydrolase family 5).
225344	BglC	2.20e-17	71	335	72	363	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW26442.1|GH5_22	0.0	1	469	1	469
QMW38521.1|GH5_22	0.0	1	469	1	469
UCK59003.1|GH5_22	0.0	1	469	12	480
CAP80303.1|GH5_22	1.38e-307	1	468	1	468
APA13270.1|GH5_22	1.87e-246	1	469	1	469

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	5.04e-22	60	363	16	342	Chain A, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	1.26e-21	60	363	16	342	Chain A, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
6UJE_A	4.31e-15	74	363	30	312	Chain A, Endoglucanase [Clostridioides difficile],6UJF_A Chain A, Endoglucanase [Clostridioides difficile]
3AMC_A	5.99e-14	85	355	46	306	Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMC_B Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMD_A Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_B Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_C Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_D Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3MMU_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_E Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_F Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_G Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_H Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima]
3AMG_A	3.51e-13	85	355	46	306	Crystal structures of Thermotoga maritima Cel5A in complex with Cellobiose substrate, mutant form [Thermotoga maritima MSB8],3AMG_B Crystal structures of Thermotoga maritima Cel5A in complex with Cellobiose substrate, mutant form [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|W8QRE4|XYL5_PHACH	6.13e-186	6	465	4	469	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2
sp|P23340|GUNC_CLOSF	1.04e-21	60	363	16	342	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
sp|A3DJ77|GUNC_ACET2	1.04e-21	60	363	16	342	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
sp|P0C2S3|GUNC_ACETH	2.59e-21	60	363	16	342	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
sp|A1D4Q5|EXGA_NEOFI	7.61e-17	8	341	30	390	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000000

TMHMM  Annotations     

There is no transmembrane helices in GAQ05827.1.