CAZyme Information: GAQ05395.1

Basic Information

• Species: Aspergillus lentulus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus lentulus
• CAZyme ID: GAQ05395.1
• CAZy Family: GH12
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
854		93442.29	4.8247

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlentulusIFM54703	9916	N/A	259	9657

• Gene Location: location=BCLY01000005:54781-57345(-)

Full Sequence      

MNRDPITPVVERLLQCLTLEEKVTLLAGKNMWETVQIDRLGIPSLKMTDGPAGARGSKWT
YGSLTTFVPCGISLAATWDPALVEKVGTVLGEETRRKRCQVLLAPTMNLSRSPLGGRNFE
GYGEDPYLVGAMSTAMIRGIQSQGVGACMKHFIANDTETRRFNVDQTIDDRTLREVYMKP
FVMALDASPWTAMVSYPKINGLHADVSPAILRPLLREELQFDRLVMSDWGGCNDTVQSLI
ATTDLEMPGPAIRRGERLLAAIRDGQVDSALHVDPSVRRMLQLLEKASLLSEESDGNRSS
VSQDEAAEQATDDPVFHQIAREAAQSGLVLLKNEDNVLPLQPSSFRKVAILGPNARKPTA
GGAGSAAVNPFYITTPEECLTKAIQTAHPEVQVIYEPGMPFSLRPPLLGNLLTVPDSSQQ
GLHITFFAGHAFEGPAVATRHWADSLIYLMSDGDVPDFLKGQPYCYRATGVVTPRVSGRY
TFSLANTGKAKLFLDEKLLIDNMEWTKVSNGFLGCSSEDKMVSVELEAGRQYALRVDNVV
TLPAVEAFDNTLFPNVTGLRIGLALEEDETAMMERAIVSACEADVAVLVVGHNKDSEGEG
GDRPDIQLPGRTDELVAAVCAANPNTIVVLQAASAVSMPWAEQARAIVLAWYQGQENGHA
LADVLLGVCNFSGKTPITFPRRLEDPGSSAWFPAEAAQDRSVFGEKVLVGYRWFEEQAIV
PMWPFGFGLSYTSFKLSDVRLSGAMTTISSQIVVHARVANVGGRDGHEVVQVYVSPSARI
QDKGLVSYRKTLAGFCKVWVPAGEQRDVTISVKSEELRWYDEQEGQWQLDRGQYRCFVGT
SVSDIDCELTFNVE

Enzyme Prediction     

No EC number prediction in GAQ05395.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	36	248	1.5e-63	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	9.68e-68	29	361	47	370	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	2.26e-65	35	845	97	757	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	2.31e-45	328	731	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.73e-38	39	283	63	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	6.39e-29	5	849	48	779	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW31943.1|GH3	0.0	10	853	9	851
QRD91011.1|GH3	0.0	10	853	11	853
QMW43976.1|GH3	0.0	10	853	9	851
BAE61700.1|GH3	0.0	10	853	9	851
UDD60911.1|GH3	0.0	10	853	9	851

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	3.05e-140	10	854	6	837	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	7.97e-136	10	854	6	837	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	4.72e-111	10	845	5	660	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	9.37e-96	17	845	12	655	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	2.62e-95	13	853	57	828	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P27034|BGLS_RHIRD	1.79e-168	9	853	1	810	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|Q5BFG8|BGLB_EMENI	4.49e-163	10	854	11	839	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|A1CUR8|BGLH_ASPCL	2.49e-157	10	854	7	821	Probable beta-glucosidase H OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglH PE=3 SV=1
sp|Q5BB53|BGLI_EMENI	1.69e-153	10	834	6	812	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2
sp|Q2U9M7|BGLH_ASPOR	2.39e-153	10	854	5	819	Probable beta-glucosidase H OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglH PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000000

TMHMM  Annotations     

There is no transmembrane helices in GAQ05395.1.