CAZyme Information: GAQ05357.1

Basic Information

• Species: Aspergillus lentulus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus lentulus
• CAZyme ID: GAQ05357.1
• CAZy Family: GH115
• CAZyme Description: endo-1,4-beta-xylanase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
286		29806.04	5.9529

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlentulusIFM54703	9916	N/A	259	9657

• Gene Location: location=BCLY01000004:4294727-4295697(-)

Full Sequence      

MISFSSLSLSLAFIAGTYALPGDKSVNLAERQTITSSQTGTNNGYYYSFWTNGAGSVQYT
NGAGGEYSVTWANQNGGDFTCGKGWNPGSDHDITFSGSFNPSGNAYLSVYGWTTSPLVEY
YILENYGSYNPGSSMTHKGTVTSDGSTYDIYEHQQVNQPSIIGTATFNQYWSIRQNKRSS
GTVTTANHFKAWASLGMNLGTHNYQIVSTEGYESSGTSTITVSSGGSSSGGSGGSSSTTS
SGSSPTGGSGSCSALWGQCGGIGWSGPTCCSSGTCKASNSYYSQCL

Enzyme Prediction     

EC	3.2.1.8:67

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH11	43	221	4.8e-74	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395367	Glyco_hydro_11	2.68e-104	43	219	1	175	Glycosyl hydrolases family 11.
197593	fCBD	8.82e-10	254	286	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
395595	CBM_1	2.36e-09	255	282	1	29	Fungal cellulose binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEV23009.1|GH11|3.2.1.8	3.69e-157	1	229	1	229
AGW24301.1|CBM1|GH11	3.65e-140	1	286	1	310
ADX86897.1|CBM1|GH11	3.65e-140	1	286	1	310
ADV31286.1|CBM1|GH11|3.2.1.8	3.65e-140	1	286	1	310
ACP27609.1|GH11	2.40e-134	1	230	1	230

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WP3_A	1.11e-101	27	223	13	207	Xylanase 11C from Talaromyces cellulolyticus (formerly known as Acremonium cellulolyticus) [Talaromyces funiculosus],3WP3_B Xylanase 11C from Talaromyces cellulolyticus (formerly known as Acremonium cellulolyticus) [Talaromyces funiculosus]
1TE1_B	1.25e-101	32	223	1	190	Crystal structure of family 11 xylanase in complex with inhibitor (XIP-I) [Talaromyces funiculosus]
5HXV_A	9.07e-97	34	223	3	190	Chain A, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_B Chain B, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_C Chain C, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_D Chain D, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_E Chain E, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_F Chain F, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_G Chain G, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_H Chain H, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_I Chain I, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_J Chain J, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_K Chain K, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_L Chain L, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612]
4XPV_A	3.02e-85	39	223	6	189	Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],4XQ4_A Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],4XQ4_B Chain B, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],6JXL_A Crystal Structures of Endo-beta-1,4-xylanase II Complexed with Xylotriose [Trichoderma reesei RUT C-30],6K9O_A Crystal Structure Analysis of Protein [Trichoderma reesei RUT C-30],6KWD_A Crystal Structure Analysis of Endo-beta-1,4-Xylanase II Complexed with Xylotriose [Trichoderma reesei RUT C-30]
6KVV_A	3.12e-85	39	223	7	190	Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei RUT C-30],6KW9_A Crystal Structure Analysis of Endo-beta-1,4-xylanase II Complexed with Xylotriose [Trichoderma reesei RUT C-30],6KWF_A Crystal Structure Analysis of Endo-beta-1,4-xylanase II Complexed with Xylotriose [Trichoderma reesei RUT C-30]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|E7EF85|XYNB_PENOX	6.49e-141	1	286	1	310	Endo-1,4-beta-xylanase B OS=Penicillium oxalicum OX=69781 GN=xynB PE=1 SV=1
sp|B7SIW1|XYNB_PHACH	1.36e-116	1	286	1	290	Endo-1,4-beta-xylanase B OS=Phanerodontia chrysosporium OX=2822231 GN=xynB PE=1 SV=1
sp|W0HJ53|XYN2_RHIOR	7.67e-113	1	223	1	216	Endo-1,4-beta-xylanase 2 OS=Rhizopus oryzae OX=64495 GN=xyn2 PE=1 SV=1
sp|Q9HFH0|XYNC_TALFU	3.00e-102	27	223	29	223	Endo-1,4-beta-xylanase C OS=Talaromyces funiculosus OX=28572 GN=xynC PE=1 SV=1
sp|Q2PGY1|XYNA_PENCI	6.20e-98	1	223	1	217	Endo-1,4-beta-xylanase A OS=Penicillium citrinum OX=5077 GN=xynA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000305	0.999668	CS pos: 19-20. Pr: 0.9699

TMHMM  Annotations     

There is no transmembrane helices in GAQ05357.1.