CAZyme Information: GAQ05329.1

Basic Information

• Species: Aspergillus lentulus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus lentulus
• CAZyme ID: GAQ05329.1
• CAZy Family: GH10|CBM1
• CAZyme Description: probable beta-glucosidase I

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
878	BCLY01000004|CGC26	96741.09	6.4687

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlentulusIFM54703	9916	N/A	259	9657

• Gene Location: location=BCLY01000004:4207765-4210625(+)

Full Sequence      

MANKGMDRSFMTACVEDLVQSMSLTEKVSLLSGEDWWRTTAVPRLNIPSIKLTDGPNGAR
GQSFFKMTPAVVLPNATGLAATFSPTLPAEAARLLAAETKARGAVCLLAPTINICRSPLG
GRTFESFGEDPTLSGIMAAKHVNALQDEGISAAIKHFVANDQEHERMGQDSIIAPRALRE
IYLRPFHIAQALAKPWSYMTSYNKLNGTHCSEHDWLLTGLLRTEWGFDGLVMSDWMGTYS
VAEAINAGLDLEMPGKPRWRQLPLVRQLINAHKIAPATIDERVITILKWVQKLVVLNPDT
VYGRDDSIEWTRTEDQATDAALIRRIGNEAIVMLKNESSVLPIRRGKVAVIGPNAKNAVI
TGGGSARLRPAWCVTPWQGLVDNKPDEVDLRYTLGCKGSKFLPVFGEEFTSMDGTTRGFD
MLHYAIVDGKQASQPAVSEVWTNSDIMLADFSHPGLGDDYFTEIRALFTAPITGDWQFEI
SVTGQAWVYVDDRLLADLSKEQKRTSSFFGNGGNGTVITFSVTKGKVCNQIVPRLAYKSL
TFNQVYRFRLLHDSRKPPLAPGQDSQPLQLIGMKLGSFPAINEDRTIDEAVELAKESDIA
LLVVGLDQDWESESYDRPNLSLPLRMNDLIRRVATEAPNTKKVVILQTGSAVSMPWLEHV
DAVLWPWYGGNEAGNAIADIVYGTVNPSGRLPITLPKRELDIAANLNFKSARTKTYYEEG
IWVGYRHFNARGIEPMYPFGHGLSYSTFDYSNLTVSPSASSSPDSWRISVSARVTNTGTV
PGAHSVHFYTSPPAPTMTSLTHPDVTLQAFAKTAVLLPGQSETIAVEMDKFAISHWDELT
STWQAEPGQWHVKIGRDAQTMCAAAPFNVSPGFRWHGI

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	41	254	1.4e-62	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.74e-61	44	859	101	755	beta-glucosidase BglX.
224389	BglX	1.98e-58	41	367	54	374	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	2.39e-48	574	745	68	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	4.38e-35	44	287	63	314	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	1.00e-33	18	793	56	711	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ91447.1|GH3	0.0	1	878	1	860
QKD55271.1|GH3	0.0	1	878	1	860
CBX93190.1|GH3	0.0	1	878	1	861
AUB23806.1|GH3	0.0	1	878	1	862
AFR94189.2|GH3	0.0	1	878	1	862

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.82e-177	15	878	6	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	7.56e-173	15	878	6	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.62e-110	11	859	1	658	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	1.55e-91	15	869	4	713	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
5WAB_A	1.12e-90	19	865	9	659	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WLY1|BGLJ_ASPFU	2.64e-198	15	878	14	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglJ PE=3 SV=2
sp|B0Y8M8|BGLJ_ASPFC	5.26e-198	15	878	14	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglJ PE=3 SV=2
sp|A1DNN8|BGLJ_NEOFI	4.03e-197	15	878	14	864	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	1.27e-194	15	854	6	815	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	1.27e-194	15	854	6	815	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000001

TMHMM  Annotations     

There is no transmembrane helices in GAQ05329.1.