CAZyme Information: GAQ05072.1

Basic Information

• Species: Aspergillus lentulus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus lentulus
• CAZyme ID: GAQ05072.1
• CAZy Family: CE8
• CAZyme Description: Choline dehydrogenase [Source:UniProtKB/TrEMBL;Acc:A0A0S7DQP8]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
647	BCLY01000004|CGC22	69832.15	4.6323

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlentulusIFM54703	9916	N/A	259	9657

• Gene Location: location=BCLY01000004:3419281-3421286(-)

Full Sequence      

MIIPRLFGLLAATAGVAKAVNITGYEYVVVGSGAGGGPLAARLALAGHKTLLLEAGDDQG
ETFNYTIPAYSARASEDEKLAWNFFVHHYADDERQARDFKTTYETPSGELYTGLNPPEGS
TLMGTLYPRTGTLGGCTAHNALIAVYPHHSDFEYISTLTGDSSWSPDNMRKYFAKLERNH
YLLPGMEGHGYDGWLQTETAPLSIVLEDPQLLSMLTGGAFALGNLTDNVINIATLLAGDA
NADTTTRDTVSGYYQIPISTDDAHRNGAREFIIAVRDAKNTDGTKKYPLDVRMNTHVTKV
TFDETVDPPRATGVEFLDGQHLYKASPLSKTASAGIPGSATASREVIVAGGVYNSPQILK
LSGIGPADELNKFGIKVIKDLPGVGTNLQDHYEISVQGKIEEDFSCLNGCTFSIHDEADP
CINRWETPILGDRGIYSSPGLAATMLYKSSVTADDSFDIFCFGGPVNFRGYFPDYSINAT
DEHNWFTWAILKAHPRNTAGTVALQSANPLDVPKITFNYFDTGVGDYDADLTALYEAIEL
ARDAFKRQLVNVTEVLPGAAVTSKEDIENYVKDAAWGHHASCTCPIGADDDPMAVLDSKF
RVRGVSGLRVVDASVYPKIPGTFTAVSTYMVAEKAADEILSELAASS

Enzyme Prediction     

No EC number prediction in GAQ05072.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	24	641	1.4e-97	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	4.34e-66	39	640	20	532	choline dehydrogenase; Validated
225186	BetA	2.89e-60	39	647	22	541	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	3.97e-36	500	635	5	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.94e-18	289	642	235	579	Protein HOTHEAD
366272	GMC_oxred_N	2.14e-13	125	393	19	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA61171.1|AA3	0.0	1	647	1	647
BCS21087.1|AA3	0.0	1	646	1	646
QMW33146.1|AA3	0.0	1	643	1	645
QRD84722.1|AA3	0.0	1	643	1	645
QMW45179.1|AA3	0.0	1	643	1	645

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YS2_AAA	2.30e-42	25	636	8	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6ZH7_A	3.13e-42	25	636	8	557	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YRU_AAA	3.13e-42	25	636	8	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	3.13e-42	25	636	8	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
5NCC_A	3.83e-42	25	636	24	573	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7MF12|BETA_VIBVY	1.78e-47	25	640	5	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1
sp|Q8D3K2|BETA_VIBVU	1.18e-46	25	640	5	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1
sp|Q6LGH5|BETA_PHOPR	3.82e-44	23	640	3	531	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1
sp|B2K8U4|BETA_YERPB	1.80e-43	25	639	3	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) OX=502801 GN=betA PE=3 SV=1
sp|Q66D54|BETA_YERPS	1.80e-43	25	639	3	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.002789	0.997184	CS pos: 19-20. Pr: 0.9450

TMHMM  Annotations     

There is no transmembrane helices in GAQ05072.1.