CAZyme Information: GAQ03899.1

Basic Information

• Species: Aspergillus lentulus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus lentulus
• CAZyme ID: GAQ03899.1
• CAZy Family: PL4
• CAZyme Description: Glycosyltransferase family 31 protein [Source:UniProtKB/TrEMBL;Acc:A0A0S7DN81]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
436	BCLY01000001|CGC37	49813.84	5.7225

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlentulusIFM54703	9916	N/A	259	9657

• Gene Location: location=BCLY01000001:3966090-3967446(-)

Full Sequence      

MPLFQPWTRLPSRRIYLISPVIGLLLVYFFFAFDTDVFTPRVVVTPISPQQEPATCPPLP
GIEDVLVILKTGVTEALEKVPVHFQTTLRCIPNYVLFSDFEEEINGTHAHDVLRSVNETI
KRTNPDFDLYNRIHEHGRSGLSPADLSRVPNTAFGMPDNPGWKLDKWKFLPMIDETLQVR
DDAKWYVFMEADTYYIWSNLLQWLAKLDPNKPYYLGNPTQIGPDIFGHGGSGFILSREAM
RRASELRAEDVDGWDRYTGEQWAGDCVLGRLLHDAGVPLLWSWPMLQSNTPAEFDHFSEA
YSKKPWCFPAVSYHHVTAKDIQEIAKFDQRFMQNNSIILHSDVFRHLVHPQFKPLQPDWD
NLSDEEHVIGEASCQELCASKPECLQYLYEAGKCRTSKMAKIGAPKTGVSSGWMTDRIDA
IVKELGSCTKPQWVLP

Enzyme Prediction     

No EC number prediction in GAQ03899.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367085	Fringe	0.005	181	288	83	203	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
215605	PLN03153	0.007	182	320	210	346	hypothetical protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW28702.1|GT31	1.14e-170	1	435	1	438
QRD83231.1|GT31	1.14e-170	1	435	1	438
UDD56757.1|GT31	1.14e-170	1	435	1	438
BAE58433.1|GT31	1.61e-170	1	435	1	438
QMW40773.1|GT31	9.25e-170	1	435	1	438

PDB Hits     

GAQ03899.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0VC84|C1GLT_BOVIN	5.16e-06	181	324	160	319	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Bos taurus OX=9913 GN=C1GALT1 PE=2 SV=1
sp|Q7SYI5|C1GTB_DANRE	9.25e-06	146	306	121	284	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-B OS=Danio rerio OX=7955 GN=c1galt1b PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000012	0.000012

TMHMM  Annotations     

Start	End
13	32