CAZyme Information: GAQ02941.1

Basic Information

• Species: Aspergillus lentulus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus lentulus
• CAZyme ID: GAQ02941.1
• CAZy Family: AA3
• CAZyme Description: probable endo-1,4-beta-xylanase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
476		51610.30	6.7300

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlentulusIFM54703	9916	N/A	259	9657

• Gene Location: location=BCLY01000001:890295-892739(-)

Full Sequence      

MVSFSSLVLALSTVAGVLAAPGSEQYVELAKRQLSSSQTGTNNGYYYSFWTDGGGKVTYT
NGNGGQYSVDWTNCGNFVAGKGWNPGSERTVTYSGSWEPSGNSYLSVYGWMTDPLVEYYI
VESYGSYNPSSGATHLGTVESDGGTYGLYKTTRTNAPSIQGTANFDQYWSVRTSHRVGGT
VTTKNHFDAWTKAGLKLGNFNYMIVATEGYQSSGSATITFYRINFRGKALITAITMASCL
AVLLLGFDQGVMSSIIGAQNRFGRDFNNSDAAMQVGDGMTSSTAPVYQSECSPVGIRGAL
LTLQGTVTILGVVIAYCFTESSFHWRFPLSFQENMHMSRNLAPILSGAVQCTYLVGNAIL
VLQMDRFGRRTLLMVCSAGLCLFRDGFDPPLAGAEHRWEMFIIFAVLNAAFIPMVYCFYP
ETKGPELEVIPLLFAKWGVTGGVLSSKGGRTVTPGQYARDVQVDRKVEVQEVETAG

Enzyme Prediction     

EC	3.2.1.8:67

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH11	43	219	4.7e-76	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395367	Glyco_hydro_11	3.21e-118	43	217	1	175	Glycosyl hydrolases family 11.
340914	MFS_HXT	2.73e-09	275	434	111	403	Fungal Hexose transporter subfamily of the Major Facilitator Superfamily of transporters and similar proteins. The fungal hexose transporter (HXT) subfamily is comprised of functionally redundant proteins that function mainly in the transport of glucose, as well as other sugars such as galactose and fructose. Saccharomyces cerevisiae has 20 genes that encode proteins in this family (HXT1 to HXT17, GAL2, SNF3, and RGT2). Seven of these (HXT1-7) encode functional glucose transporters. Gal2p is a galactose transporter, while Rgt2p and Snf3p act as cell surface glucose receptors that initiate signal transduction in response to glucose, functioning in an induction pathway responsible for glucose uptake. Rgt2p is activated by high levels of glucose and stimulates expression of low affinity glucose transporters such as Hxt1p and Hxt3p, while Snf3p generates a glucose signal in response to low levels of glucose, stimulating the expression of high affinity glucose transporters such as Hxt2p and Hxt4p. Schizosaccharomyces pombe contains eight GHT genes (GHT1-8) belonging to this family. Ght1, Ght2, and Ght5 are high-affinity glucose transporters; Ght3 is a high-affinity gluconate transporter; and Ght6 high-affinity fructose transporter. The substrate specificities for Ght4, Ght7, and Ght8 remain undetermined. The HXT subfamily belongs to the Glucose transporter -like (GLUT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.
340873	MFS_GLUT_like	1.55e-07	275	382	99	256	Glucose transporters (GLUTs) and other similar sugar transporters of the Major Facilitator Superfamily. This family is composed of glucose transporters (GLUTs) and other sugar transporters including fungal hexose transporters (HXT), bacterial xylose transporter (XylE), plant sugar transport proteins (STP) and polyol transporters (PLT), H(+)-myo-inositol cotransporter (HMIT), and similar proteins. GLUTs, also called Solute carrier family 2, facilitated glucose transporters (SLC2A), are a family of proteins that facilitate the transport of hexoses such as glucose and fructose. There are fourteen GLUTs found in humans; they display different substrate specificities and tissue expression. They have been categorized into three classes based on sequence similarity: Class 1 (GLUTs 1-4, 14); Class 2 (GLUTs 5, 7, 9, and 11); and Class 3 (GLUTs 6, 8, 10, 12, and HMIT). GLUT proteins are comprised of about 500 amino acid residues, possess a single N-linked oligosaccharide, and have 12 transmembrane segments. The GLUT-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.
395036	Sugar_tr	2.34e-05	275	332	114	177	Sugar (and other) transporter.
395036	Sugar_tr	6.32e-05	389	434	407	452	Sugar (and other) transporter.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADM47839.1|GH11	3.57e-135	1	219	1	219
BAA19744.1|GH11	3.04e-116	1	219	1	219
QRD93485.1|GH11	3.04e-116	1	219	1	219
BAE56664.1|GH11|3.2.1.8	3.04e-116	1	219	1	219
QMW46754.1|GH11	3.04e-116	1	219	1	219

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TE1_B	4.37e-98	32	219	1	188	Crystal structure of family 11 xylanase in complex with inhibitor (XIP-I) [Talaromyces funiculosus]
3WP3_A	1.11e-97	28	219	13	205	Xylanase 11C from Talaromyces cellulolyticus (formerly known as Acremonium cellulolyticus) [Talaromyces funiculosus],3WP3_B Xylanase 11C from Talaromyces cellulolyticus (formerly known as Acremonium cellulolyticus) [Talaromyces funiculosus]
5HXV_A	2.05e-93	34	219	3	188	Chain A, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_B Chain B, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_C Chain C, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_D Chain D, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_E Chain E, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_F Chain F, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_G Chain G, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_H Chain H, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_I Chain I, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_J Chain J, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_K Chain K, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_L Chain L, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612]
7DFM_A	4.01e-86	34	219	5	189	Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 [Streptomyces olivaceoviridis],7DFM_B Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 [Streptomyces olivaceoviridis],7DFM_C Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 [Streptomyces olivaceoviridis],7DFM_D Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 [Streptomyces olivaceoviridis],7DFN_A Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with alpha-L-arabinofuranosyl xylotetraose [Streptomyces olivaceoviridis],7DFN_B Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with alpha-L-arabinofuranosyl xylotetraose [Streptomyces olivaceoviridis],7DFN_C Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with alpha-L-arabinofuranosyl xylotetraose [Streptomyces olivaceoviridis],7DFN_D Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with alpha-L-arabinofuranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_A Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_B Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_C Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_D Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_E Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_F Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_G Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_H Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_I Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis]
1HIX_A	9.63e-86	34	219	4	188	Crystallographic Analyses Of Family 11 Endo-Beta-1,4- Xylanase Xyl1 From Streptomyces Sp. S38 [Streptomyces sp. S38],1HIX_B Crystallographic Analyses Of Family 11 Endo-Beta-1,4- Xylanase Xyl1 From Streptomyces Sp. S38 [Streptomyces sp. S38]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DNU5|XYNB_NEOFI	1.25e-145	1	219	1	219	Probable endo-1,4-beta-xylanase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=xlnB PE=3 SV=1
sp|B0Y8Q8|XYNB_ASPFC	1.93e-137	1	219	1	219	Probable endo-1,4-beta-xylanase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=xlnB PE=3 SV=1
sp|Q4WLV2|XYNB_ASPFU	1.93e-137	1	219	1	219	Probable endo-1,4-beta-xylanase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=xlnB PE=3 SV=1
sp|A1CU59|XYNB_ASPCL	5.91e-124	1	219	1	219	Probable endo-1,4-beta-xylanase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=xlnB PE=3 SV=2
sp|P87037|XYNB_ASPOR	5.40e-117	1	219	1	219	Probable endo-1,4-beta-xylanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=xlnB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000256	0.999734	CS pos: 19-20. Pr: 0.9850

TMHMM  Annotations     

Start	End
229	247
341	363
398	420