CAZyme Information: GAQ02788.1

Basic Information

• Species: Aspergillus lentulus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus lentulus
• CAZyme ID: GAQ02788.1
• CAZy Family: AA2
• CAZyme Description: Glycosyl transferase [Source:UniProtKB/TrEMBL;Acc:A0A0S7DD71]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
395	BCLY01000001|CGC5	45203.35	6.0574

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlentulusIFM54703	9916	N/A	259	9657

• Gene Location: location=BCLY01000001:382292-383479(-)

Full Sequence      

MVEKKFAPISLFPKRARRFTHGSLATLFLFIYFCVTRTSHNIGETRSYSNQVTANVGGTF
PRKIWQIWKVNPLEFDERDIEVARSWTAKNPGYRYEVLTDQNDLEYVETNFGPLGENRPD
IVETYRSLTAPIIKADLLRYLVMYIEGGVYADIDVEALRPVERFVPNTHDERDIGMVIGI
EIDEPEFSDHPILGQKSRSFCQWTFMCKPRQPVMMRLVENILHWLNELSIKQGKPISELQ
LDFDDVITGTGPSAFTSAILSEMSRTTGKTVTWDTFHDIPESKVVGGFLVLTVEAFAAGQ
GHSDSGTHNSRNALVKHHYHASEWPKRHPRFYHPIFGEVEKCNWNMDCVKKWDEETTAFA
ALPQEEQERQIAIFQAIGEALKKMEPPPQPAFGGF

Enzyme Prediction     

No EC number prediction in GAQ02788.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	82	166	2e-20	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.99e-23	59	221	81	243	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	5.66e-15	76	160	1	82	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP95522.1|GT32	2.34e-245	1	387	1	385
QMW40889.1|GT32	2.31e-193	13	377	7	368
BAE58544.1|GT32	2.31e-193	13	377	7	368
UDD56882.1|GT32	2.31e-193	13	377	7	368
QMW28814.1|GT32	9.36e-193	13	377	7	368

PDB Hits     

GAQ02788.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	1.29e-33	67	324	146	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	4.55e-29	60	317	99	369	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	4.62e-27	60	296	130	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	2.34e-21	40	239	78	300	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	2.37e-10	25	162	18	150	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000014	0.000008

TMHMM  Annotations     

There is no transmembrane helices in GAQ02788.1.