CAZyme Information: GAQ02751.1

Basic Information

• Species: Aspergillus lentulus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus lentulus
• CAZyme ID: GAQ02751.1
• CAZy Family: AA13
• CAZyme Description: probable pectate lyase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
776	BCLY01000001|CGC36	81999.73	6.1864

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AlentulusIFM54703	9916	N/A	259	9657

• Gene Location: location=BCLY01000001:282811-285673(+)

Full Sequence      

MKLSAPLLVSLAAFSQAVTALVAFPGAEGFGANAIGGRKGQVYVVTNLNDSGTGSLRDAV
SATDRIVVFAVGGVIKISDRIVVSKRVTILGQTAPGDGITVYGNGWSFSNADDAIVRYIR
IRMGKGGSSGKDAMGIAEGNRMIFDHVSVSWGRDETFSINGDASNITIQNSIIAQGLETH
SCGGLIQTDGGVSLFRNLYIDNKTRNPKVKGVNEFTNNVVYNWGGGGGYIAGDSDGQSYA
NIIGNYFISGPSTSVTAFTRGNANFHGYVENNYYDPDKDGQLDGSALGVSSSNYGGMAIV
PSKYNYPAVAYTMSPAEAVTYVTKYAGASKVRDSVDTQLITQVQSWGTKGALISDEATMG
GPGSLNGGTPAKDTDGDGIPDEAEKQLGTDPNTNDSMKLHTLAATCPSLPSSPQLQAIST
LPDPFSWYPLQQSGRVTTLSDWQCRQSHISTLLQQLELGTKPPAPSSVTSTFSQNKLTIT
ASNAGKTISFTATITYPSSGAGPYPAMIAYGGLSIPLPPGVATITFDNSQIAQQNDQSSR
GKGLFYTLYGANHAAGAMMAWAWATSLIIDRLEATPAARINTARIGVTGCSRNGKGALVA
GAFDSRIALTVPQESGTGGSGCWRLAAASEGAPQNVQTAGEIVQENVWFSTAFNTYANNV
DQLPFDHHMLAGLIAPRGLLSIDNAGYQWLGPWSSLGCMGTARLIWQAMGVPDRMGYSMS
TNHPHCSFPDQQRDDLFAFVNRFLLGMDVNTTVQKNYAGIAFDSKPWVNWQVPTLT

Enzyme Prediction     

EC	-	3.1.1.-:10

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE15	420	745	2.7e-85	0.9925650557620818
PL1	72	247	3.9e-54	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226384	PelB	4.91e-10	7	331	14	344	Pectate lyase [Carbohydrate transport and metabolism].
408654	TSP3_bac	2.03e-06	373	392	1	20	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.
214765	Amb_all	4.67e-04	74	251	5	190	Amb_all domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP91803.1|PL1_2	9.10e-268	1	405	1	405
CAP91804.1|CE15|3.1.1.-	1.37e-259	402	776	17	391
QMW43898.1|PL1_2	6.70e-223	6	405	5	404
UDD60834.1|PL1_2	9.49e-223	6	405	5	404
QRD90936.1|PL1_2	1.91e-222	6	405	5	404

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PIC_A	8.13e-133	404	776	9	375	Chain A, Cip2 [Trichoderma reesei],3PIC_B Chain B, Cip2 [Trichoderma reesei],3PIC_C Chain C, Cip2 [Trichoderma reesei]
6RU2_A	4.06e-115	421	776	18	380	Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor [Cerrena unicolor],6RU2_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor [Cerrena unicolor]
6RTV_A	1.06e-114	421	776	24	386	Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant [Cerrena unicolor],6RTV_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant [Cerrena unicolor],6RU1_A Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid Um4X [Cerrena unicolor],6RU1_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid Um4X [Cerrena unicolor],6RV7_A Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid UXXR [Cerrena unicolor],6RV7_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid UXXR [Cerrena unicolor],6RV9_A Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid XUXXR [Cerrena unicolor],6RV9_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid XUXXR [Cerrena unicolor]
6RV8_A	1.24e-114	402	776	77	458	Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor covalent complex with the aldouronic acid UXXR [Cerrena unicolor],6RV8_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor covalent complex with the aldouronic acid UXXR [Cerrena unicolor]
4G4G_A	4.04e-102	421	775	59	410	Crystal structure of recombinant glucuronoyl esterase from Sporotrichum thermophile determined at 1.55 A resolution [Thermothelomyces thermophilus ATCC 42464]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DPF0|PLYC_NEOFI	2.06e-276	1	405	1	405	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1
sp|B0XMA2|PLYC_ASPFC	1.05e-271	1	405	1	405	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1
sp|Q4WL88|PLYC_ASPFU	1.49e-271	1	405	1	405	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1
sp|Q0CLG7|PLYC_ASPTN	2.24e-231	8	405	7	404	Probable pectate lyase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyC PE=3 SV=1
sp|B8NQQ7|PLYC_ASPFN	3.39e-223	6	405	5	404	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000523	0.999450	CS pos: 20-21. Pr: 0.6560

TMHMM  Annotations     

There is no transmembrane helices in GAQ02751.1.