CAZyme Information: FVEG_17613-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_17613-t26_1-p1
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
501		56997.94	5.4637

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000587.1:566121-567626(+)

Full Sequence      

MEHPELYDIADRLGIMIIAGWECCDRWEAWPYNDDISQNPPQRWSEVDYETANASIRHEA
AMMQTHPSMIAFLVGSDYWPDDRATAIYLEGLHDAGWQVPVISSAAKRGYPKALGPSGMK
MEGPYDWVPPVYWFDREPTDNRSGSSFGFGSELGAGVGTPTKGSLTRFLTDKDMEDLWKK
PNKGLYHMSQNTSQFYDRSIYNKALYARYGKPTSLDDYLMKAQMMDYEATRSEFEGWASQ
WSASRPATGLIYWMLNNAWPSLHWNQFDYYLHPAGSYFGTKIANGVEHVAFDYFRSFIWT
INQSLDQSGPRSVHVDLVDLKGNYISHQKLHYTTEPNKSQRIGDISSSIKRITEVGVLRL
LLVDDDTEKVLSRNAYWLSKQKDLVDWTTTSWYSVDVKQSANFTALNTMEQAAIAASASS
NKTSGVWKLRIENNATVPAVFIQLNLVGKHGKDVTPLTWSDNYFTLLPRESIEVELTDWS
GKGAMVQIYGKNVEESWIKLG

Enzyme Prediction     

EC	3.2.1.165:3

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408168	Ig_GlcNase	6.04e-26	392	493	1	104	Exo-beta-D-glucosaminidase Ig-fold domain. This domain can be found in 2 glycoside hydrolase subfamily of beta-glucosaminidases (EC:3.2.1.165) such as CsxA, from Amycolatopsis orientalis that has exo-beta-D-glucosaminidase (exo-chitosanase) activity. It has an immunoglobulin-like topology.
407658	Mannosidase_ig	1.58e-05	298	383	5	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
407625	Ig_mannosidase	3.39e-04	423	477	9	57	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGJ00523.1|GH2	0.0	1	501	395	895
QGI69635.1|GH2	0.0	1	501	395	895
CCT74191.1|GH2	0.0	1	501	395	895
QGI86986.1|GH2	0.0	1	501	376	870
CEI66195.1|GH2	6.95e-292	1	500	395	894

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VZS_A	1.02e-92	1	492	397	890	Chitosan Product complex of Amycolatopsis orientalis exo-chitosanase CsxA [Amycolatopsis orientalis],2VZS_B Chitosan Product complex of Amycolatopsis orientalis exo-chitosanase CsxA [Amycolatopsis orientalis],2X05_A Inhibition of the exo-beta-D-glucosaminidase CsxA by a glucosamine- configured castanospermine and an amino-australine analogue [Amycolatopsis orientalis],2X05_B Inhibition of the exo-beta-D-glucosaminidase CsxA by a glucosamine- configured castanospermine and an amino-australine analogue [Amycolatopsis orientalis],2X09_A Inhibition of the exo-beta-D-glucosaminidase CsxA by a glucosamine- configured castanospermine and an amino-australine analogue [Amycolatopsis orientalis],2X09_B Inhibition of the exo-beta-D-glucosaminidase CsxA by a glucosamine- configured castanospermine and an amino-australine analogue [Amycolatopsis orientalis]
2VZO_A	3.80e-92	1	492	397	890	Crystal structure of Amycolatopsis orientalis exo-chitosanase CsxA [Amycolatopsis orientalis],2VZO_B Crystal structure of Amycolatopsis orientalis exo-chitosanase CsxA [Amycolatopsis orientalis]
2VZT_A	7.34e-92	1	492	397	890	Complex of Amycolatopsis orientalis exo-chitosanase CsxA E541A with PNP-beta-D-glucosamine [Amycolatopsis orientalis],2VZT_B Complex of Amycolatopsis orientalis exo-chitosanase CsxA E541A with PNP-beta-D-glucosamine [Amycolatopsis orientalis],2VZV_A Substrate Complex of Amycolatopsis orientalis exo-chitosanase CsxA E541A with chitosan [Amycolatopsis orientalis],2VZV_B Substrate Complex of Amycolatopsis orientalis exo-chitosanase CsxA E541A with chitosan [Amycolatopsis orientalis]
2VZU_A	1.96e-90	1	492	397	890	Complex of Amycolatopsis orientalis exo-chitosanase CsxA D469A with PNP-beta-D-glucosamine [Amycolatopsis orientalis],2VZU_B Complex of Amycolatopsis orientalis exo-chitosanase CsxA D469A with PNP-beta-D-glucosamine [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|C0LRA7|EBDG_HYPVI	2.75e-216	1	500	386	890	Exo-beta-D-glucosaminidase OS=Hypocrea virens OX=29875 GN=gls1 PE=2 SV=1
sp|Q4R1C4|EBDG_HYPJE	1.33e-214	1	500	388	892	Exo-beta-D-glucosaminidase OS=Hypocrea jecorina OX=51453 GN=gls93 PE=1 SV=1
sp|D4AUH1|EBDG_ARTBC	9.31e-182	2	498	394	882	Exo-beta-D-glucosaminidase ARB_07888 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07888 PE=1 SV=1
sp|Q82NR8|EBDG_STRAW	1.95e-100	1	498	404	901	Exo-beta-D-glucosaminidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=csxA PE=1 SV=1
sp|Q56F26|EBDG_AMYOR	3.78e-92	1	492	397	890	Exo-beta-D-glucosaminidase OS=Amycolatopsis orientalis OX=31958 GN=csxA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000003

TMHMM  Annotations     

There is no transmembrane helices in FVEG_17613-t26_1-p1.