CAZyme Information: FVEG_14131-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_14131-t26_1-p1
• CAZy Family: GT34
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
489		53964.20	7.4911

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=DS486011.1:30675-32525(+)

Full Sequence      

MVHVLLLASLGLGSSVLAAPNYAVPDVQPKNAVAIDPAPVGASFEFFMWPSYMTNISLTL
PCISHFNKLYNRKMPIRIGGTTQDRATYDPDLKGYVSYSVNDPLEAPMNLTYGPKFFDLI
KKFGSETILGFNRGLNNRTNTFAAVLKAKEKVAKYLWAIELGNEPDLYWKYWQYPVAEAP
WNETQEGNNAADWAQDFINHWKSPLPILAGGGYAIPFEIEPDWPNLLYLIESSYNKTVKD
ATKVYNGHLYAFSNATADDLGPEMKHQRVVQDLSLLPISSAKAAGRPYILGETGFHGLDY
EMDSTFGSAIQTTDKTLRALTLGIQRLFYHQGTINQAFFNWWWSGHVNAPFYGAYFGALA
VAGGDSIVASDDGTDPYAQYIVYKNGKAFKVVLINTDYYSGGGTRSETKFTLTGLKSNSV
KALRMTAPSSETTVPVTQTKSSPQPSIGGQSFSNKNCELSGKQNAERLSVKKGKLEVTLK
ASEALIIYL

Enzyme Prediction     

EC	3.2.1.31:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH79	40	421	9.9e-39	0.8835164835164835

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407104	Glyco_hydro_79C	5.53e-23	380	486	2	103	Glycosyl hydrolase family 79 C-terminal beta domain. This domain is found at the C-terminus of glycosyl hydrolase family 79 proteins. It's function is not yet known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD56667.1|GH79	0.0	1	489	1	489
CCT70706.1|GH79	0.0	1	489	1	489
QGI83786.1|GH79	0.0	1	489	1	489
QGI97434.1|GH79	0.0	1	489	1	489
QGI66544.1|GH79	0.0	1	489	1	489

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7DFQ_A	3.55e-83	21	489	4	459	Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum],7DFS_A Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QEQ6|GUS79_ASPNC	1.08e-20	8	395	31	436	Beta-glucuronidase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=An02g11890 PE=1 SV=1
sp|Q7SFB0|GUS79_NEUCR	2.67e-16	15	341	15	362	Beta-glucuronidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU00937 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000264	0.999726	CS pos: 18-19. Pr: 0.9799

TMHMM  Annotations     

There is no transmembrane helices in FVEG_14131-t26_1-p1.