CAZyme Information: FVEG_13766-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_13766-t26_1-p1
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
602		65769.63	8.1725

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000587.1:456823-458681(+)

Full Sequence      

MHLSYLLVQGLLAVSAGASRHRRVRRQKGPTDPGIPSDCTYWETVEADGQDCTYLEDLWE
LEHATFVEYNPSVKDDCSGIQLGHSYCVEVNNGFPRDDDPPKVTGTRGTGPEPTQATKPS
PTQDGLIDTCTSFYEAKKGDTCNKIIAQYKTFDFDDFFKWNPAVDKDCSGIWANTWYCVG
VPGTPTSPPTKTIVTTTKPTGTPKPSQTQEGLIESCTAFHMAEKGDTCARIVSKFGTFDF
DTFYKWNPAVGKDCSGIWASYYYCVGVPGTATVKPSATTPKPTATGGIETPSPIQEGLVK
NCNKFHQITSTTTCSSIESYYKLPLAQFLAWNPAVGKDCTSLWKGYWVCINVEGYRPTTT
TTAKPTTTKPANGITTPSPIQDGMVKNCEKFHQIKSTTTCTSIENYYNLPLSTFLSWNPA
VGKDCTSLLVNYWVCVATVGWKPPTKTTTKAATTTKGSSNGIKTPPPVQPGMVSNCNKFH
MVQKTTTCDSIQNYYKISLADFVKWNPAVGSKCTGLWADYNVCVGVIGGTPTKPDNGVKT
PSPIQPGMVSNCKKFHQVASTTTCDSIQKYYKITMAQLAKWNPAVGTKCTALWAKYWVCV
GV

Enzyme Prediction     

EC	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
212030	LysM	1.40e-06	554	598	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
212030	LysM	1.68e-05	478	522	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
212030	LysM	1.63e-04	304	348	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
197609	LysM	0.002	479	524	1	44	Lysin motif.
197609	LysM	0.004	133	167	1	34	Lysin motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD61254.1|CBM50	0.0	1	602	1	599
QKD59082.1|CBM50	0.0	1	602	1	599
QGI87027.1|CBM50	0.0	1	602	1	661
QGI69682.1|CBM50	0.0	1	602	1	686
QGJ00570.1|CBM50	0.0	1	602	1	686

PDB Hits     

FVEG_13766-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ALG0|LYSM1_ARTBC	1.99e-105	247	601	98	456	LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05157 PE=1 SV=1
sp|D4B4P8|LYSM2_ARTBC	7.51e-19	130	269	29	183	LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03438 PE=3 SV=1
sp|D4AVW3|LYSM5_ARTBC	1.06e-16	181	433	232	527	LysM domain-containing protein ARB_00327 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00327 PE=3 SV=2
sp|D4AZ68|LYSM3_ARTBC	2.27e-14	14	352	15	408	LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01488 PE=3 SV=1
sp|D4B5F9|PGDA_ARTBC	1.05e-11	530	602	351	437	Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03699 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.542199	0.457793

TMHMM  Annotations     

There is no transmembrane helices in FVEG_13766-t26_1-p1.